Overview

  • Product name

  • Description

    Rabbit polyclonal to CD58
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD58 aa 40-220.
    Sequence:

    NVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGS LTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIE VQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTL SNPLFNTTSSIILTTCIPSSGHSRHRYALIP


    Database link: P19256

  • Positive control

    • IHC-P: Human thymus tissue.
  • General notes

    Previously labelled as LFA3.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238566 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AG3 antibody
    • CD58 antibody
    • CD58 antigen (lymphocyte function associated antigen 3)1 antibody
    • CD58 antigen antibody
    • CD58 antigen, (lymphocyte function associated antigen 3) antibody
    • CD58 molecule antibody
    • FLJ23181 antibody
    • FLJ43722 antibody
    • LFA 3 antibody
    • LFA-3 antibody
    • LFA3 antibody
    • LFA3_HUMAN antibody
    • Lymphocyte Function Associated Antigen Type 3 antibody
    • Lymphocyte function-associated antigen 3 antibody
    • Surface glycoprotein LFA 3 antibody
    • Surface glycoprotein LFA-3 antibody
    see all

Images

  • Paraffin-embedded human thymus tissue stained for CD58 using ab238566 at 1/100 dilution in immunohistochemical analysis.

References

ab238566 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238566.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up