Overview

  • Product name

  • Description

    Rabbit polyclonal to CD62E
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Dog
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Dog CD62E aa 23-240. Expressed in E.coli. N-terminal tags.
    Sequence:

    WSYNASTEAMTFDEASTYCQQRYTHLVAIQNQEEIKYLNSMFTYTPTYYW IGIRKVNKKWTWIGTQKLLTEEAKNWAPGEPNNKQNDEDCVEIYIKRDKD SGKWNDERCDKKKLALCYTAACTPTSCSGHGECVETVNNYTCKCHPGFRG LRCEQVVTCQAQEAPEHGSLVCTHPLGTFSYNSSCFVSCDKGYLPSSTEA TQCTSTGEWSASPPACNV


    Database link: P33730

  • Positive control

    • WB: Recombinant dog CD62E protein; Dog serum.

Properties

Applications

Our Abpromise guarantee covers the use of ab231258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
  • Sequence similarities

    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 6 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD26E antibody
    • CD62 antigen-like family member E antibody
    • CD62E antibody
    • E selectin antibody
    • E-selectin antibody
    • ELAM antibody
    • ELAM-1 antibody
    • ELAM1 antibody
    • Endothelial adhesion molecule 1 antibody
    • Endothelial leukocyte adhesion molecule 1 antibody
    • ESEL antibody
    • LECAM2 antibody
    • Leukocyte-endothelial cell adhesion molecule 2 antibody
    • LYAM2_HUMAN antibody
    • Sele antibody
    • Selectin E antibody
    see all

Images

  • Anti-CD62E antibody (ab231258) at 2 µg/ml + Recombinant dog CD62E protein

References

ab231258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up