Overview

  • Product name

  • Description

    Rabbit polyclonal to CD62P
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse CD62P aa 720-768 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TTGLAVGGTLLALLRKRLRKKDDGKCPLNPHSHLGTYGVFTNAAYDPTP


    Database link: Q01102

  • Positive control

    • IHC-P: Rat colon and pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab202983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with PSGL1.
  • Tissue specificity

    Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.
  • Involvement in disease

    Defects in SELP may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similarities

    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 9 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen CD62 antibody
    • CD62 antibody
    • CD62 antigen-like family member P antibody
    • CD62P antibody
    • GMP 140 antibody
    • GMP-140 antibody
    • GMP140 antibody
    • GMRP antibody
    • Granule membrane protein 140 antibody
    • Granulocyte membrane protein antibody
    • GRMP antibody
    • LECAM 3 antibody
    • LECAM3 antibody
    • Leukocyte endothelial cell adhesion molecule 3 antibody
    • Leukocyte-endothelial cell adhesion molecule 3 antibody
    • LYAM3_HUMAN antibody
    • P Selectin antibody
    • P-selectin antibody
    • PADGEM antibody
    • Platelet activation dependent granule-external membrane protein antibody
    • Platelet alpha granule membrane protein antibody
    • PSEL antibody
    • Selectin P (granule membrane protein 140kDa, antigen CD62) antibody
    • SELP antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat pancreas tissue labeling CD62P using ab202983 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat colon tissue labeling CD62P using ab202983 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up