Anti-CD63 antibody [MX-49.129.5] - BSA and Azide free (ab213092)

Overview

  • Product name

    Anti-CD63 antibody [MX-49.129.5] - BSA and Azide free
    See all CD63 primary antibodies
  • Description

    Mouse monoclonal [MX-49.129.5] to CD63 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Cow, Cat
  • Immunogen

    Full length protein corresponding to Human CD63 aa 1-238.
    Sequence:

    MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPG SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAA AIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAAN YTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR KNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM


    Database link: P08962

  • Positive control

    • ICC/IF: HeLa cells. WB: Human spleen tissue lysate. IHC-P: Human prostate carcinoma and human melanoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab213092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    This antigen is associated with early stages of melanoma tumor progression. May play a role in growth regulation.
  • Tissue specificity

    Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages.
  • Sequence similarities

    Belongs to the tetraspanin (TM4SF) family.
  • Cellular localization

    Cell membrane. Lysosome membrane. Late endosome membrane. Also found in Weibel-Palade bodies of endothelial cells. Located in platelet dense granules.
  • Information by UniProt
  • Database links

  • Alternative names

    • Lysosomal associated membrane protein 3 antibody
    • CD 63 antibody
    • CD63 antibody
    • CD63 antigen (melanoma 1 antigen) antibody
    • CD63 antigen antibody
    • CD63 antigen melanoma 1 antigen antibody
    • CD63 molecule antibody
    • CD63_HUMAN antibody
    • gp55 antibody
    • Granulophysin antibody
    • LAMP 3 antibody
    • LAMP-3 antibody
    • LAMP3 antibody
    • LIMP antibody
    • Lysosomal-associated membrane protein 3 antibody
    • Lysosome associated membrane glycoprotein 3 antibody
    • Lysosome-associated membrane glycoprotein 3 antibody
    • Mast cell antigen AD1 antibody
    • ME491 antibody
    • Melanoma 1 antigen antibody
    • Melanoma associated antigen ME491 antibody
    • Melanoma associated antigen MLA1 antibody
    • Melanoma-associated antigen ME491 antibody
    • MGC72893 antibody
    • MLA 1 antibody
    • MLA1 antibody
    • NGA antibody
    • Ocular melanoma associated antigen antibody
    • Ocular melanoma-associated antigen antibody
    • OMA81H antibody
    • PTLGP40 antibody
    • Tetraspanin 30 antibody
    • Tetraspanin-30 antibody
    • Tspan 30 antibody
    • Tspan-30 antibody
    • TSPAN30 antibody
    see all

Images

  • Anti-TECPR1 antibody (ab103092) at 1 µg/ml + human spleen lysate at 2 µg
  • Immunohistochemical analysis of paraffin embedded, formalin fixed human prostate carcinoma tissue labeling CD63 with ab213092 at 1 μg/ml dilution.

  • Immunohistochemical analysis of paraffin embedded, formalin fixed human melanoma tissue labeling CD63 with ab213092 at 1 μg/ml dilution.

  • Immunofluorescent analysis of HeLa cells labeling CD63 using Alexa Fluor® 488 conjugated ab213092 (green). Red: F-actin filaments labeled with Dylight554 phalloidin. Blue: DAPI nuclear staining.

References

ab213092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up