Overview

  • Product name

  • Description

    Rabbit polyclonal to CD64
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human CD64 aa 100-150 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    IHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHW N


    Database link: P12314

  • Positive control

    • Rat brain and lung tissues; Human colon carcinoma lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab203349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 43 kDa.

Target

  • Function

    High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
  • Tissue specificity

    Monocyte/macrophage specific.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. FCGR1 family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated on serine residues.
  • Cellular localization

    Cell membrane. Stabilized at the cell membrane through interaction with FCER1G.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 64 antibody
    • CD64 antibody
    • CD64 antigen antibody
    • CD64A antibody
    • CD64b antibody
    • CD64c antibody
    • Fc fragment of IgG high affinity Ia receptor antibody
    • Fc fragment of IgG high affinity Ib receptor antibody
    • Fc fragment of IgG high affinity Ic receptor antibody
    • Fc fragment of IgG, high affinity Ia, receptor (CD64) antibody
    • Fc fragment of IgG, high affinity Ia, receptor for (CD64) antibody
    • Fc fragment of IgG, high affinity Ia, receptor for antibody
    • Fc fragment of IgG, high affinity Ib, receptor (CD64) antibody
    • Fc fragment of IgG, high affinity Ib, receptor for antibody
    • Fc fragment of IgG, high affinity Ic, receptor (CD64) antibody
    • Fc fragment of IgG, high affinity Ic, receptor (CD64), pseudogene antibody
    • Fc fragment of IgG, high affinity Ic, receptor for antibody
    • Fc gamma receptor antibody
    • Fc gamma receptor I A1 antibody
    • Fc gamma receptor I antibody
    • Fc gamma receptor I B2 antibody
    • Fc gamma RI antibody
    • Fc gamma RIA antibody
    • Fc gamma RIB antibody
    • Fc of IgG high affinity Ia receptor antibody
    • Fc-gamma RI antibody
    • Fc-gamma RIA antibody
    • Fc-gamma RIC antibody
    • FCG 1 antibody
    • FCG1 antibody
    • FcgammaRI antibody
    • FcgammaRIa antibody
    • FCGR 1 antibody
    • FCGR1 antibody
    • FCGR1_HUMAN antibody
    • FCGR1A antibody
    • FCGR1B antibody
    • FCGR1C antibody
    • FcRI antibody
    • FcRIB antibody
    • FCRIC antibody
    • FLJ18345 antibody
    • HFcgammaRIB antibody
    • High affinity immunoglobulin gamma Fc receptor I antibody
    • High affinity immunoglobulin gamma Fc receptor IB antibody
    • IGFR 1 antibody
    • IGFR1 antibody
    • IGFRB antibody
    • IGFRC antibody
    • IgG Fc receptor I antibody
    • IgG Fc receptor IB antibody
    • IgG Fc receptor IC antibody
    • Immunoglobulin G Fc receptor I antibody
    • Immunoglobulin G Fc receptor IB antibody
    • Immunoglobulin G Fc receptor IC antibody
    • MGC137713 antibody
    see all

Images

  • All lanes : Anti-CD64 antibody (ab203349) at 1/200 dilution

    Lane 1 : Rat lung lysate
    Lane 2 : Human colon carcinoma lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 43 kDa
    Observed band size: 41 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat lung tissue labeling CD64 with ab203349 at 1/200 dilution, followed by conjugation to the secondary antibody.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling CD64 with ab203349 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rabbit Tissue sections (Liver pig)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citratbuffer, EDTA buffer
Specification
Liver pig
Blocking step
HRP Polymer Kit as blocking agent for 5 minute(s) · Concentration: 3% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted May 03 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up