Overview

  • Product name

    Anti-CD66b antibody [2F12E8]
    See all CD66b primary antibodies
  • Description

    Mouse monoclonal [2F12E8] to CD66b
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD66b aa 43-178. (Expressed in E.coli).
    Sequence:

    SNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPG PAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHP ETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLW


    Database link: P31997

  • Positive control

    • WB: Recombinant human CD66b (aa 43-178) protein; CD66b (aa 43-178)-hIgG-Fc-transfected HEK-293 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2F12E8
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 38 kDa.

Target

  • Tissue specificity

    Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carcinoembryonic antigen CGM6 antibody
    • Carcinoembryonic antigen gene family member 6 antibody
    • Carcinoembryonic antigen related cell adhesion molecule 8 antibody
    • Carcinoembryonic antigen-related cell adhesion molecule 8 antibody
    • CD 66b antibody
    • CD 67 antibody
    • CD66b antibody
    • CD66b antigen antibody
    • CD67 antibody
    • CD67 antigen antibody
    • CEACAM 8 antibody
    • CEACAM8 antibody
    • CEAM8_HUMAN antibody
    • CGM 6 antibody
    • CGM6 antibody
    • NCA 95 antibody
    • NCA95 antibody
    • Non-specific cross-reacting antigen NCA-95 antibody
    • Nonspecific cross reacting antigen NCA 95 antibody
    • Nonspecific cross reacting antigen NCA95 antibody
    see all

Images

  • Anti-CD66b antibody [2F12E8] (ab233811) at 1/500 dilution + Recombinant human CD66b (aa 43-178) protein

    Predicted band size: 38 kDa



    Expected MW is 41.2 kDa.

  • All lanes : Anti-CD66b antibody [2F12E8] (ab233811) at 1/500 dilution

    Lane 1 : Non-transfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : CD66b (aa 43-178)-hIgG-Fc-transfected HEK-293 cell lysate

    Predicted band size: 38 kDa

References

ab233811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up