Anti-CD66b antibody (ab214175)
Key features and details
- Rabbit polyclonal to CD66b
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CD66b antibody
See all CD66b primary antibodies -
Description
Rabbit polyclonal to CD66b -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human CD66b aa 60-110 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:QDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLM R
Database link: P31997 -
Positive control
- Human colon carcinoma tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab214175 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. |
Target
-
Tissue specificity
Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow. -
Sequence similarities
Belongs to the immunoglobulin superfamily. CEA family.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 1088 Human
- Omim: 615747 Human
- SwissProt: P31997 Human
- Unigene: 41 Human
-
Alternative names
- Carcinoembryonic antigen CGM6 antibody
- Carcinoembryonic antigen gene family member 6 antibody
- Carcinoembryonic antigen related cell adhesion molecule 8 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD66b antibody (ab214175)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling CD66b with ab214175 at 1/200 dilution, followed by conjugation to a secondary antibody and DAB staining.
References (1)
ab214175 has been referenced in 1 publication.
- Zhou C et al. Development and validation of a seven-immune-feature-based prognostic score for oral squamous cell carcinoma after curative resection. Int J Cancer N/A:N/A (2019). PubMed: 31304591