Overview

  • Product name

  • Description

    Rabbit polyclonal to CD69
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CD69 aa 1-199.
    Sequence:

    MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVF ITILIIALIALSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFIS TVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPG HPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK


    Database link: Q07108

  • Positive control

    • Human lung extract. Human tonsil

Properties

Applications

Our Abpromise guarantee covers the use of ab175391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 23 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Antigen retrieval: Tris EDTA buffer, duration 30 minutes.

Target

  • Function

    Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
  • Tissue specificity

    Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    Earliest inducible cell surface glycoprotein acquired during lymphoid activation.
  • Post-translational
    modifications

    Constitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activation inducer molecule (AIM/CD69) antibody
    • Activation inducer molecule antibody
    • AIM antibody
    • BL-AC/P26 antibody
    • BLAC/P26 antibody
    • C-type lectin domain family 2 member C antibody
    • CD69 antibody
    • CD69 antigen (p60, early T-cell activation antigen) antibody
    • CD69 antigen antibody
    • CD69 molecule antibody
    • CD69_HUMAN antibody
    • CLEC2C antibody
    • EA1 antibody
    • Early activation antigen CD69 antibody
    • Early lymphocyte activation antigen antibody
    • Early T cell activation antigen p60 antibody
    • Early T-cell activation antigen p60 antibody
    • GP32/28 antibody
    • Leu23 antibody
    • Leukocyte surface antigen Leu-23 antibody
    • MLR-3 antibody
    • MLR3 antibody
    • VEA antibody
    • Very Early Activation Antigen antibody
    see all

Images

  • Anti-CD69 antibody (ab175391) at 1/500 dilution + Mouse lung extract.

    Predicted band size: 23 kDa

References

ab175391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up