Anti-CD69 antibody (ab202909)
- Datasheet
- References (3)
- Protocols
Overview
-
Product name
Anti-CD69 antibody
See all CD69 primary antibodies -
Description
Rabbit polyclonal to CD69 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide within Human CD69 aa 100-150 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:STVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEP G
Database link: Q07108 -
Positive control
- Human lung carcinoma tissue. Mouse lung tissue. Mouse lung lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab202909 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/1000. Predicted molecular weight: 23 kDa. | |
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Use at 1/50 - 1/200 with fluorescent detection methods. |
Target
-
Function
Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. -
Tissue specificity
Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets. -
Sequence similarities
Contains 1 C-type lectin domain. -
Developmental stage
Earliest inducible cell surface glycoprotein acquired during lymphoid activation. -
Post-translational
modificationsConstitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 969 Human
- Entrez Gene: 12515 Mouse
- Entrez Gene: 29187 Rat
- Omim: 107273 Human
- SwissProt: Q07108 Human
- SwissProt: P37217 Mouse
- Unigene: 208854 Human
- Unigene: 74745 Mouse
-
Alternative names
- Activation inducer molecule (AIM/CD69) antibody
- Activation inducer molecule antibody
- AIM antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD69 antibody (ab202909)
Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse lung tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD69 antibody (ab202909)
Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human lung carcinoma tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
All lanes : Anti-CD69 antibody (ab202909) at 1/200 dilution
Lane 1 : Mouse intestine or brain lysate
Lane 2 : Mouse lung lysate
Predicted band size: 23 kDa
References
This product has been referenced in:
- Fan X et al. Overexpression of p53 delivered using recombinant NDV induces apoptosis in glioma cells by regulating the apoptotic signaling pathway. Exp Ther Med 15:4522-4530 (2018). Read more (PubMed: 29731836) »
- Sun Y et al. Natural killer cells inhibit metastasis of ovarian carcinoma cells and show therapeutic effects in a murine model of ovarian cancer. Exp Ther Med 16:1071-1078 (2018). Read more (PubMed: 30116358) »