Overview

  • Product name

  • Description

    Rabbit polyclonal to CD69
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD69 aa 100-150 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    STVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEP G


    Database link: Q07108

  • Positive control

    • Human lung carcinoma tissue. Mouse lung tissue. Mouse lung lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab202909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 23 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
  • Tissue specificity

    Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    Earliest inducible cell surface glycoprotein acquired during lymphoid activation.
  • Post-translational
    modifications

    Constitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activation inducer molecule (AIM/CD69) antibody
    • Activation inducer molecule antibody
    • AIM antibody
    • BL-AC/P26 antibody
    • BLAC/P26 antibody
    • C-type lectin domain family 2 member C antibody
    • CD69 antibody
    • CD69 antigen (p60, early T-cell activation antigen) antibody
    • CD69 antigen antibody
    • CD69 molecule antibody
    • CD69_HUMAN antibody
    • CLEC2C antibody
    • EA1 antibody
    • Early activation antigen CD69 antibody
    • Early lymphocyte activation antigen antibody
    • Early T cell activation antigen p60 antibody
    • Early T-cell activation antigen p60 antibody
    • GP32/28 antibody
    • Leu23 antibody
    • Leukocyte surface antigen Leu-23 antibody
    • MLR-3 antibody
    • MLR3 antibody
    • VEA antibody
    • Very Early Activation Antigen antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse lung tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human lung carcinoma tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-CD69 antibody (ab202909) at 1/200 dilution

    Lane 1 : Mouse intestine or brain lysate
    Lane 2 : Mouse lung lysate

    Predicted band size: 23 kDa

References

This product has been referenced in:

  • Fan X  et al. Overexpression of p53 delivered using recombinant NDV induces apoptosis in glioma cells by regulating the apoptotic signaling pathway. Exp Ther Med 15:4522-4530 (2018). Read more (PubMed: 29731836) »
  • Sun Y  et al. Natural killer cells inhibit metastasis of ovarian carcinoma cells and show therapeutic effects in a murine model of ovarian cancer. Exp Ther Med 16:1071-1078 (2018). Read more (PubMed: 30116358) »
See all 3 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Tumor)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Leica ER1 solution
Permeabilization
No
Specification
Tumor
Fixative
Formaldehyde

Zohar Gavish

Verified customer

Submitted May 13 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Tonsil)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH6
Permeabilization
No
Specification
Tonsil
Blocking step
Bloxall Endogenous Peroxidase and Alkaline Phosphatase Blocking as blocking agent for 10 minute(s) · Concentration: 100% · Temperature: 25°C
Fixative
Formaldehyde

Mr. Joshua Dodge

Verified customer

Submitted Jan 31 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (spleen)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA pH 9.0
Permeabilization
No
Specification
spleen
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Fixative
10% NBF

Abcam user community

Verified customer

Submitted Jul 30 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up