Anti-CD69 antibody (ab202909)
Key features and details
- Rabbit polyclonal to CD69
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-CD69 antibody
See all CD69 primary antibodies -
Description
Rabbit polyclonal to CD69 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide within Human CD69 aa 100-150 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:STVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEP G
Database link: Q07108 -
Positive control
- Human lung carcinoma tissue. Mouse lung tissue. Mouse lung lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab202909 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/1000. Predicted molecular weight: 23 kDa. | |
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Use at 1/50 - 1/200 with fluorescent detection methods. |
Target
-
Function
Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. -
Tissue specificity
Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets. -
Sequence similarities
Contains 1 C-type lectin domain. -
Developmental stage
Earliest inducible cell surface glycoprotein acquired during lymphoid activation. -
Post-translational
modificationsConstitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 969 Human
- Entrez Gene: 12515 Mouse
- Entrez Gene: 29187 Rat
- Omim: 107273 Human
- SwissProt: Q07108 Human
- SwissProt: P37217 Mouse
- Unigene: 208854 Human
- Unigene: 74745 Mouse
-
Alternative names
- Activation inducer molecule (AIM/CD69) antibody
- Activation inducer molecule antibody
- AIM antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD69 antibody (ab202909)Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse lung tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD69 antibody (ab202909)Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human lung carcinoma tissue labeling CD69 with ab202909 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Western blot - Anti-CD69 antibody (ab202909)All lanes : Anti-CD69 antibody (ab202909) at 1/200 dilution
Lane 1 : Mouse intestine or brain lysate
Lane 2 : Mouse lung lysate
Predicted band size: 23 kDa
Protocols
References (5)
ab202909 has been referenced in 5 publications.
- Rashid R et al. Highly multiplexed immunofluorescence images and single-cell data of immune markers in tonsil and lung cancer. Sci Data 6:323 (2019). PubMed: 31848351
- Hu H et al. Dysregulation of CD69 by overexpression of microRNA-367-3p associated with post-myocardial infarction cardiac fibrosis. Mol Med Rep 18:3085-3092 (2018). PubMed: 30015935
- Fan X et al. Overexpression of p53 delivered using recombinant NDV induces apoptosis in glioma cells by regulating the apoptotic signaling pathway. Exp Ther Med 15:4522-4530 (2018). PubMed: 29731836
- Sun Y et al. Natural killer cells inhibit metastasis of ovarian carcinoma cells and show therapeutic effects in a murine model of ovarian cancer. Exp Ther Med 16:1071-1078 (2018). PubMed: 30116358
- Dumoitier N et al. Scleroderma Peripheral B Lymphocytes Secrete Interleukin-6 and Transforming Growth Factor ß and Activate Fibroblasts. Arthritis Rheumatol 69:1078-1089 (2017). PubMed: 27992693
