For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    cd6t12-antibody-c6372--3f7b5-ab199008.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Adaptive Immunity T Cells CD
Share by email

Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)

Key features and details

  • Mouse monoclonal [C6/372 + 3F7B5] to CD6/T12
  • Suitable for: IHC-P
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Protein
Product image
Recombinant Human CD6/T12 protein (ab116984)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-CD6/T12 antibody [C6/372 + 3F7B5]
    See all CD6/T12 primary antibodies
  • Description

    Mouse monoclonal [C6/372 + 3F7B5] to CD6/T12
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    This product was produced with the following immunogens:
    Recombinant full length protein corresponding to Human CD6/T12 aa 1-668. (C6/372)
    Sequence:

    MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNG SSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPP TPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRR ARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCR QLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCG HKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLC SQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM LLIPSIVLGILLLGSLIFIAFILLRIKGKYALPVMVNHQHLPTTIPAGSN SYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALT TFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPP SLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSP SPQPDSTDNDDYDDISAA


    Database link: P30203

    Tissue, cells or virus corresponding to Human CD6/T12. Human rheumatoid synovial T cell line ST-1 (3F7B5).
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human tonsil tissue. CCRF-CEM. Jurkat cells.
  • General notes

    Please note that this antibody is an oligoclonal antibody. It is a cocktail of monoclonal antibodies that have been carefully selected. Oligoclonal antibodies have not only the specificity and batch-to-batch consistency of a monoclonal antibody, but also have the advantage of the sensitivity of a polyclonal antibody due to their ability to recognize multiple epitopes on an antigen. 

    Previously labelled as CD6. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    C6/372 + 3F7B5
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Adaptive Immunity
    • T Cells
    • CD
    • Stem Cells
    • Hematopoietic Progenitors
    • Lymphoid
    • T Lymphocytic Lineage
    • Stem Cells
    • Hematopoietic Progenitors
    • Lymphoid
    • NK Cell Lineage

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Recombinant Protein

    • Recombinant Human CD6/T12 protein (ab116984)

Applications

Our Abpromise guarantee covers the use of ab199008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Citrate Buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes)

Target

  • Function

    Involved in cell adhesion. Binds to CD166.
  • Tissue specificity

    Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain.
  • Sequence similarities

    Contains 3 SRCR domains.
  • Post-translational
    modifications

    After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.
    Contains intrachain disulfide bond(s).
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P30203 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 923 Human
    • Omim: 186720 Human
    • SwissProt: P30203 Human
    • Unigene: 744366 Human
    • Alternative names

      • CD_antigen=CD6 antibody
      • CD6 antibody
      • CD6 antigen Tp120 antibody
      • CD6 molecule antibody
      • CD6_HUMAN antibody
      • FLJ44171 antibody
      • OX52 antibody
      • T cell differentiation antigen CD6 antibody
      • T-cell differentiation antigen CD6 antibody
      • T12 antibody
      • TP120 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling CD6/T12 with ab199008 at 1 µg/ml.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling CD6/T12 with ab199008 at 1 µg/ml.

    Protocols

    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab199008? Please let us know so that we can cite the reference in this datasheet.

    ab199008 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab199008.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.