Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)
Key features and details
- Mouse monoclonal [C6/372 + 3F7B5] to CD6/T12
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-CD6/T12 antibody [C6/372 + 3F7B5]
See all CD6/T12 primary antibodies -
Description
Mouse monoclonal [C6/372 + 3F7B5] to CD6/T12 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
This product was produced with the following immunogens:
Recombinant full length protein corresponding to Human CD6/T12 aa 1-668. (C6/372)
Sequence:MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNG SSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPP TPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRR ARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCR QLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCG HKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLC SQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM LLIPSIVLGILLLGSLIFIAFILLRIKGKYALPVMVNHQHLPTTIPAGSN SYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALT TFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPP SLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSP SPQPDSTDNDDYDDISAA
Database link: P30203
Tissue, cells or virus corresponding to Human CD6/T12. Human rheumatoid synovial T cell line ST-1 (3F7B5). -
Positive control
- Human tonsil tissue. CCRF-CEM. Jurkat cells.
-
General notes
Please note that this antibody is an oligoclonal antibody. It is a cocktail of monoclonal antibodies that have been carefully selected. Oligoclonal antibodies have not only the specificity and batch-to-batch consistency of a monoclonal antibody, but also have the advantage of the sensitivity of a polyclonal antibody due to their ability to recognize multiple epitopes on an antigen.
Previously labelled as CD6.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 99% PBS, 0.05% BSA -
Concentration information loading...
-
Purity
Protein A/G purified -
Clonality
Monoclonal -
Clone number
C6/372 + 3F7B5 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab199008 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 0.5 - 1 µg/ml. Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Citrate Buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes) |
Target
-
Function
Involved in cell adhesion. Binds to CD166. -
Tissue specificity
Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain. -
Sequence similarities
Contains 3 SRCR domains. -
Post-translational
modificationsAfter T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.
Contains intrachain disulfide bond(s). -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 923 Human
- Omim: 186720 Human
- SwissProt: P30203 Human
- Unigene: 744366 Human
-
Alternative names
- CD_antigen=CD6 antibody
- CD6 antibody
- CD6 antigen Tp120 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling CD6/T12 with ab199008 at 1 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD6/T12 antibody [C6/372 + 3F7B5] (ab199008)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling CD6/T12 with ab199008 at 1 µg/ml.
Datasheets and documents
References (0)
ab199008 has not yet been referenced specifically in any publications.