Overview

  • Product name

  • Description

    Rabbit polyclonal to CD7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat CD7 aa 23-128. Expressed in E. coli.
    Sequence:

    QEVHQSPRVVIASEGESINITCSTRGDLEGLIMKRIWPQASNVIYFEDEL EPTVDSAFSGRINFSGSQKNLTIIMSLLQEADTGAYTCEAVRKVSVHGLF TTVVVK


    Database link: B2RZ54

  • Positive control

    • IHC-P: Rat testis, spinal cord, kidney, stomach, heart and cerebrum tissue. WB: Recombinant rat CD7 protein; Rat spleen and thymus lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Function

    Not yet known.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD7 antibody
    • CD7 antigen (p41) antibody
    • CD7 antigen antibody
    • CD7 molecule antibody
    • CD7_HUMAN antibody
    • GP40 antibody
    • LEU 9 antibody
    • LEU9 antibody
    • p41 protein antibody
    • T cell antigen CD7 antibody
    • T cell leukemia antigen antibody
    • T cell surface antigen Leu 9 antibody
    • T-cell antigen CD7 antibody
    • T-cell leukemia antigen antibody
    • T-cell surface antigen Leu-9 antibody
    • Tp 40 antibody
    • Tp40 antibody
    • TP41 antibody
    see all

Images

  • All lanes : Anti-CD7 antibody (ab231101) at 1 µg/ml

    Lane 1 : Rat spleen lysate
    Lane 2 : Rat thymus lysate

    Secondary
    All lanes : HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 23 kDa

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for CD7 with ab231101 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat cerebrum tissue stained for CD7 with ab231101 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for CD7 with ab231101 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for CD7 with ab231101 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for CD7 with ab231101 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for CD7 with ab231101 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD7 antibody (ab231101) at 2 µg/ml + Recombinant rat CD7 protein

    Developed using the ECL technique.

    Predicted band size: 23 kDa

References

ab231101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up