Overview

  • Product name

  • Description

    Rabbit Polyclonal to CD72
  • Host species

    Rabbit
  • Specificity

    ab201079 detects endogenous levels of CD72.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human CD72 aa 192-237.
    Sequence:

    RQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGW


    Database link: P21854

  • Positive control

    • RAW264.7, H9C2 and HeLa cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purity >95% by SDS-PAGE.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 40 kDa.

Target

  • Function

    Plays a role in B-cell proliferation and differentiation.
  • Tissue specificity

    Pre-B-cells and B-cells but not terminally differentiated plasma cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    Phosphorylated upon engagement of the B-cell receptor, probably by LYN or SYK. Phosphorylation at Tyr-7 is important for interaction with PTPN6/SHP-1.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell differentiation antigen CD72 antibody
    • B-cell differentiation antigen CD72 antibody
    • CD_antigen=CD72 antibody
    • CD72 antibody
    • CD72 antigen antibody
    • CD72 molecule antibody
    • CD72_HUMAN antibody
    • CD72b antibody
    • CD72c antibody
    • Ly-19 antibody
    • Ly-32 antibody
    • Ly-m19 antibody
    • Lyb-2 antibody
    • Lyb2 antibody
    • LYB2, mouse, homolog of antibody
    • Lymphocyte antigen 32 antibody
    • MGC108873 antibody
    see all

Images

  • All lanes : Anti-CD72 antibody (ab201079)

    Lane 1 : RAW264.7 whole cell lysate
    Lane 2 : H9C2 whole cell lysate
    Lane 3 : HeLa whole cell lysate

    Predicted band size: 40 kDa

References

ab201079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up