Overview

  • Product name

  • Description

    Rabbit polyclonal to CD72
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD72 aa 165-311.
    Sequence:

    AQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLS NMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETL SSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTD


    Database link: P21854

  • Positive control

    • Human lymph node tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab204336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role in B-cell proliferation and differentiation.
  • Tissue specificity

    Pre-B-cells and B-cells but not terminally differentiated plasma cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    Phosphorylated upon engagement of the B-cell receptor, probably by LYN or SYK. Phosphorylation at Tyr-7 is important for interaction with PTPN6/SHP-1.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell differentiation antigen CD72 antibody
    • B-cell differentiation antigen CD72 antibody
    • CD_antigen=CD72 antibody
    • CD72 antibody
    • CD72 antigen antibody
    • CD72 molecule antibody
    • CD72_HUMAN antibody
    • CD72b antibody
    • CD72c antibody
    • Ly-19 antibody
    • Ly-32 antibody
    • Ly-m19 antibody
    • Lyb-2 antibody
    • Lyb2 antibody
    • LYB2, mouse, homolog of antibody
    • Lymphocyte antigen 32 antibody
    • MGC108873 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling CD72 with ab204336 at 1/500 dilution.

References

ab204336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up