Overview

  • Product name

  • Description

    Rabbit polyclonal to CD72
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat CD72 aa 126-237. Expressed in E.coli.
    Sequence:

    VSRIWEATNSSLQQQLREEKRQLKQKVEDLRESRRELNSTQDTFQEKQKM YEVTKQQLQDCQAESQRTKESLKTEEQRRQDLDQSLRNTRDTLRRLSSCS SDTCCPSGWVQH


    Database link: Q5BK59

  • Positive control

    • IHC-P: Rat spleen tissue. WB: Rat spleen tissue lysate; mouse testis tissue lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab231106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function

    Plays a role in B-cell proliferation and differentiation.
  • Tissue specificity

    Pre-B-cells and B-cells but not terminally differentiated plasma cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    Phosphorylated upon engagement of the B-cell receptor, probably by LYN or SYK. Phosphorylation at Tyr-7 is important for interaction with PTPN6/SHP-1.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell differentiation antigen CD72 antibody
    • B-cell differentiation antigen CD72 antibody
    • CD_antigen=CD72 antibody
    • CD72 antibody
    • CD72 antigen antibody
    • CD72 molecule antibody
    • CD72_HUMAN antibody
    • CD72b antibody
    • CD72c antibody
    • Ly-19 antibody
    • Ly-32 antibody
    • Ly-m19 antibody
    • Lyb-2 antibody
    • Lyb2 antibody
    • LYB2, mouse, homolog of antibody
    • Lymphocyte antigen 32 antibody
    • MGC108873 antibody
    see all

Images

  • Anti-CD72 antibody (ab231106) at 2 µg/ml + Mouse testis lysate

    Predicted band size: 42 kDa

  • Anti-CD72 antibody (ab231106) at 2 µg/ml + Rat spleen lysate

    Predicted band size: 42 kDa

  • Anti-CD72 antibody (ab231106) at 2 µg/ml + Recombinant rat CD72 protein

    Predicted band size: 42 kDa

  • Formalin-fixed, paraffin-embedded rat spleen tissue stained for CD72 with ab231106 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up