Overview

  • Product name

    Anti-CD72 antibody - N-terminal
    See all CD72 primary antibodies
  • Description

    Rabbit polyclonal to CD72 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD72 aa 1-40 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYE


    Database link: P21854

  • Positive control

    • Human cervical carcinoma and Human gastric carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab202843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 40 kDa.

Target

  • Function

    Plays a role in B-cell proliferation and differentiation.
  • Tissue specificity

    Pre-B-cells and B-cells but not terminally differentiated plasma cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    Phosphorylated upon engagement of the B-cell receptor, probably by LYN or SYK. Phosphorylation at Tyr-7 is important for interaction with PTPN6/SHP-1.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell differentiation antigen CD72 antibody
    • B-cell differentiation antigen CD72 antibody
    • CD_antigen=CD72 antibody
    • CD72 antibody
    • CD72 antigen antibody
    • CD72 molecule antibody
    • CD72_HUMAN antibody
    • CD72b antibody
    • CD72c antibody
    • Ly-19 antibody
    • Ly-32 antibody
    • Ly-m19 antibody
    • Lyb-2 antibody
    • Lyb2 antibody
    • LYB2, mouse, homolog of antibody
    • Lymphocyte antigen 32 antibody
    • MGC108873 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human gastric carcinoma tissue labeling CD72 with ab202843 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human cervical carcinoma tissue labeling CD72 with ab202843 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab202843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up