Overview

  • Product name

    Anti-CD74 antibody [CLIP/813]
    See all CD74 primary antibodies
  • Description

    Mouse monoclonal [CLIP/813] to CD74
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CD74 aa 1-296.
    Sequence:

    MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALY TGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKP PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNAD PLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQ KPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYC WCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM


    Database link: P04233

  • Positive control

    • IHC-P: Human tonsil tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    CLIP/813
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab215898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells.
ICC/IF Use a concentration of 1 - 2 µg/ml.

Target

  • Function

    Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.
  • Sequence similarities

    Contains 1 thyroglobulin type-1 domain.
  • Cellular localization

    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus > trans-Golgi network. Endosome. Lysosome. Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 74 antibody
    • CD74 antibody
    • CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) antibody
    • CD74 antigen antibody
    • CD74 molecule antibody
    • CD74 molecule, major histocompatibility complex, class II invariant chain antibody
    • CLIP antibody
    • DHLAG antibody
    • Gamma chain of class II antigens antibody
    • HG2A_HUMAN antibody
    • HLA class II histocompatibility antigen gamma chain antibody
    • HLA DR antigens associated invariant chain antibody
    • HLA DR gamma antibody
    • HLA-DR antigens-associated invariant chain antibody
    • HLA-DR-gamma antibody
    • HLADG antibody
    • HLADR antigens associated invariant chain antibody
    • Ia antigen associated invariant chain antibody
    • Ia antigen-associated invariant chain antibody
    • Ia associated invariant chain antibody
    • Ia gamma antibody
    • Ii antibody
    • Invariant polypeptide of major histocompatibility complex class II antigen associated antibody
    • la-gamma antibody
    • Major histocompatibility complex class II invariant chain antibody
    • MHC HLA DR gamma chain antibody
    • MHC HLA-DR gamma chain antibody
    • p33 antibody
    • p35 antibody
    • Protein 41 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling CD74 with ab215898 at 2 µg/mL.

References

ab215898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up