Overview

  • Product name

  • Description

    Rabbit polyclonal to CD79a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CD79a aa 36-219. N-terminal tags. (Expressed in E.coli).
    Sequence:

    HKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGE DPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLD MGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDE NLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIG


    Database link: P11912

  • Positive control

    • IHC-P: Human stomach tissue. WB: Raji cell lysate; Recombinant human CD79a protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B cells.
  • Tissue specificity

    B-cells.
  • Involvement in disease

    Defects in CD79A are the cause of agammaglobulinemia type 3 (AGM3) [MIM:613501]. It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. Note=Two different mutations, one at the splice donor site of intron 2 and the other at the splice acceptor site for exon 3, have been identified. Both mutations give rise to a truncated protein.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine, serine and threonine residues upon B-cell activation. Phosphorylation of tyrosine residues by Src-family kinases is an early and essential feature of the BCR signaling cascade. The phosphorylated tyrosines serve as docking sites for SH2-domain containing kinases, leading to their activation which in turn leads to phosphorylation of downstream targets. Phosphorylation of serine and threonine residues may prevent subsequent tyrosine phosphorylation.
  • Cellular localization

    Cell membrane. Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
  • Information by UniProt
  • Database links

  • Alternative names

    • B lymphocyte-specific MB1 protein antibody
    • B-cell antigen receptor complex-associated protein alpha chain antibody
    • CD 79a antibody
    • CD79a antibody
    • CD79a antigen (immunoglobulin-associated alpha) antibody
    • CD79A antigen antibody
    • CD79a molecule, immunoglobulin-associated alpha antibody
    • CD79A_HUMAN antibody
    • Ig alpha antibody
    • Ig-alpha antibody
    • IGA antibody
    • IgM-alpha antibody
    • Immunoglobulin-associated alpha antibody
    • Ly54 antibody
    • MB-1 membrane glycoprotein antibody
    • MB1 antibody
    • Membrane-bound immunoglobulin-associated protein antibody
    • Surface IgM-associated protein antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for CD79a using ab231798 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD79a antibody (ab231798) at 2 µg/ml + Recombinant human CD79a protein

    Predicted band size: 25 kDa

  • Raji (human Burkitt's lymphoma cell line) cell lysate

    Predicted band size: 25 kDa

References

ab231798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up