Overview

  • Product name

  • Description

    Rabbit polyclonal to CD8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Mouse CD8 aa 50-90 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKI


    Database link: P01731

  • Positive control

    • WB: Mouse lymph node and spleen lysate. IHC-P: Mouse spleen tissue and mouse lymphoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 26 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
  • Involvement in disease

    Defects in CD8A are a cause of familial CD8 deficiency (CD8 deficiency) [MIM:608957]. Familial CD8 deficiency is a novel autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    All of the five most C-terminal cysteines form inter-chain disulfide bonds in dimers and higher multimers, while the four N-terminal cysteines do not.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Form

    CD8 beta tissue specificity: Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells. CD8 beta PTM: Phosphorylated as a consequence of T-cell activation.
  • Alternative names

    • CD8 antibody
    • CD8 antigen, alpha polypeptide (p32) antibody
    • CD8a antibody
    • CD8a antigen antibody
    • CD8a molecule antibody
    • CD8A_HUMAN antibody
    • Leu2 antibody
    • Leu2 T lymphocyte antigen antibody
    • MAL antibody
    • OKT8 T cell antigen antibody
    • p32 antibody
    • T cell antigen Leu2 antibody
    • T cell co receptor antibody
    • T-cell surface glycoprotein CD8 alpha chain antibody
    • T-lymphocyte differentiation antigen T8/Leu-2 antibody
    • T8 T cell antigen antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse spleen tissue sections labeling CD8 using ab203035 at a 1/250 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-CD8 antibody (ab203035) at 1/300 dilution + Mouse spleen at 40 µg

    Secondary
    IRDye800CW Goat Anti-Rabbit IgG at 1/20000 dilution

    Predicted band size: 26 kDa
    Observed band size: 32 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse brain tissue sections labeling CD8 using ab203035 at a 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH6.0) for 15min; Block endogenous peroxidase by 3% hydrogen peroxide for 20 minutes; Blocking buffer (normal goat serum) at 37°C for 30min.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse lymphoma tissue labeling CD8 using ab203035 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-CD8 antibody (ab203035) at 1/300 dilution + Mouse spleen lysate

    Secondary
    Goat anti-rabbit IgG (H+L) HRP conjugated at 1/5000 dilution

    Predicted band size: 26 kDa

  • Anti-CD8 antibody (ab203035) at 1/300 dilution + Mouse lymph node lysate

    Secondary
    Conjugated secondary antibody at 1/10000 dilution

    Predicted band size: 26 kDa
    Observed band size: 32 kDa why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Li G  et al. Functional characterization of a potent anti-tumor polysaccharide in a mouse model of gastric cancer. Life Sci 219:11-19 (2019). Read more (PubMed: 30611785) »
  • Grill M  et al. Cellular localization and regulation of receptors and enzymes of the endocannabinoid system in intestinal and systemic inflammation. Histochem Cell Biol 151:5-20 (2019). Read more (PubMed: 30196316) »
See all 6 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Breast Eo771)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate Buffer, Vector laboratories(H-3300)
Permeabilization
Yes - 0.2% Triton-X
Specification
Breast Eo771
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 25°C
Fixative
Paraformaldehyde

Anugraha Rajagopalan

Verified customer

Submitted Mar 16 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (B16 tumors taken from C57bl mice)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH 6
Permeabilization
No
Specification
B16 tumors taken from C57bl mice
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Sep 18 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Heart)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citric buffer
Permeabilization
No
Specification
Heart
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Formaldehyde

Miss. Ieva Berzanskyte

Verified customer

Submitted Jun 26 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Spleen)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citric acid
Permeabilization
No
Specification
Spleen
Blocking step
BSA as blocking agent for 10 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative
Formaldehyde

Mr. Carl Hobbs

Verified customer

Submitted Mar 27 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up