Overview

  • Product name

  • Description

    Rabbit polyclonal to CD80
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Rat CD80 aa 270-321 (C terminal) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ITVIAVIAAIAIIIFCITVKFRRCFRRRNEASRETNKNLYIGPVEAAAEQ TV


    Database link: G3V671

  • Positive control

    • IHC-P: Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab215166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500.

Target

  • Function

    Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
  • Tissue specificity

    Expressed on activated B-cells, macrophages and dendritic cells.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activation B7-1 antigen antibody
    • B lymphocyte activation antigen B7 antibody
    • B7 antibody
    • B7-1 antibody
    • B7-1 antigen antibody
    • B7.1 antibody
    • BB1 antibody
    • CD28 antigen ligand 1 antibody
    • CD28LG antibody
    • CD28LG1 antibody
    • CD80 antibody
    • CD80 antigen (CD28 antigen ligand 1, B7-1 antigen) antibody
    • CD80 antigen antibody
    • CD80 molecule antibody
    • CD80_HUMAN antibody
    • Costimulatory factor CD80 antibody
    • costimulatory molecule variant IgV-CD80 antibody
    • CTLA-4 counter-receptor B7.1 antibody
    • LAB7 antibody
    • T-lymphocyte activation antigen CD80 antibody
    see all

Images

  • Anti-CD80 antibody (ab215166) at 1/500 dilution + Mouse spleen lysates

    Secondary
    Conjugated secondary antibody at 1/10000 dilution
  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded rat brain tissue labeling CD80 with ab215166 at 1/400 dilution overnight followed by a conjugated secondary and DAB staining.

References

ab215166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rat Tissue sections (Skin)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TE pH9
Permeabilization
No
Specification
Skin
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative
10% buffered formalin

Abcam user community

Verified customer

Submitted Jul 17 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Subcutaneous fat)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TE pH9
Permeabilization
No
Specification
Subcutaneous fat
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative
10% buffered formalin

Abcam user community

Verified customer

Submitted Jul 17 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Xenograft tumor)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TE pH9
Permeabilization
No
Specification
Xenograft tumor
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative
10% normal buffered formalin

Abcam user community

Verified customer

Submitted Jul 17 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (tumor)
Antigen retrieval step
Heat mediated
Permeabilization
No
Specification
tumor
Fixative
Formaldehyde

Miss. Sylvie Colin

Verified customer

Submitted Oct 20 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up