Anti-CD82 antibody [C33], prediluted (Phycoerythrin) (ab178544)

Overview

  • Product name
    Anti-CD82 antibody [C33], prediluted (Phycoerythrin)
    See all CD82 primary antibodies
  • Description
    Mouse monoclonal [C33] to CD82, prediluted (Phycoerythrin)
  • Host species
    Mouse
  • Conjugation
    Phycoerythrin. Ex: 488nm, Em: 575nm
  • Specificity
    ab178544 reacts with CD82, a widely expressed cell surface protein of the tetraspanin family. CD82 is also found in endosome/lysosome compartments.
  • Tested applications
    Suitable for: Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Tissue, cells or virus corresponding to Human CD82 aa 1-267. Immunogen is C91/PL (Human HTLV-1+ T cell line).
    Sequence:

    MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSS SLRMGAYVFI GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIA QVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVK CCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGN RTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVL SICLCRHVHSEDYSKVPKY


    Database link: P27701

Properties

Applications

Our Abpromise guarantee covers the use of ab178544 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 10µl for 106 cells.

Human whole blood use 10 µl reagent / 100 µl.

 

 

 

 

ab91363 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
  • Tissue specificity
    Lymphoid specific.
  • Sequence similarities
    Belongs to the tetraspanin (TM4SF) family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4F9 antibody
    • Antigen detected by monoclonal and antibody IA4 antibody
    • C33 antibody
    • C33 antigen antibody
    • CD 82 antibody
    • CD82 antibody
    • CD82 antigen antibody
    • CD82 molecule antibody
    • CD82_HUMAN antibody
    • GR 15 antibody
    • GR15 antibody
    • IA 4 antibody
    • IA4 antibody
    • Inducible membrane protein antibody
    • Inducible membrane protein R2 antibody
    • KAI 1 antibody
    • KAI1 antibody
    • Kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)) antibody
    • Kangai 1 antibody
    • Kangai1 antibody
    • Leukocyte surface antigen R2 antibody
    • Metastasis suppressor Kangai 1 antibody
    • Metastasis suppressor Kangai-1 antibody
    • Metastasis suppressor Kangai1 antibody
    • Prostate cancer antimetastasis gene KAI1 antibody
    • R2 antibody
    • R2 leukocyte antigen antibody
    • SAR 2 antibody
    • SAR2 antibody
    • ST 6 antibody
    • ST6 antibody
    • Suppression of tumorigenicity 6 antibody
    • Suppression of tumorigenicity 6 prostate antibody
    • Suppressor of tumorigenicity 6 antibody
    • Suppressor of tumorigenicity 6 protein antibody
    • Tetraspanin 27 antibody
    • Tetraspanin-27 antibody
    • Tetraspanin27 antibody
    • Tspan 27 antibody
    • Tspan-27 antibody
    • Tspan27 antibody
    see all

References

ab178544 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178544.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up