Overview

  • Product name

    Anti-CD83 antibody [8A4C11]
    See all CD83 primary antibodies
  • Description

    Mouse monoclonal [8A4C11] to CD83
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD83 aa 20-144. Extracellular domain. Expressed in E.coli.
    Sequence:

    TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLR GQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLS GKVILRVTGCPAQRKEETFKKYRAE


    Database link: Q01151

  • Positive control

    • WB: Recombinant human CD83 (aa 20-144) protein; Human CD83 (aa 20-144)-hIgG-Fc-transfected HEK-293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 23 kDa.

Target

  • Function

    May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
  • Tissue specificity

    Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell activation 45kDa cell surface glycoprotein Ig superfamily antibody
    • B cell activation protein antibody
    • B-cell activation protein antibody
    • BL11 antibody
    • BL11 PEN antibody
    • CD83 antibody
    • CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) antibody
    • CD83 antigen antibody
    • CD83 molecule antibody
    • CD83_HUMAN antibody
    • Cell surface glycoprotein antibody
    • Cell surface protein HB15 antibody
    • HB15 antibody
    • hCD83 antibody
    see all

Images

  • Anti-CD83 antibody [8A4C11] (ab233782) at 1/500 dilution + Recombinant human CD83 (aa 20-144) protein

    Predicted band size: 23 kDa



    Expected MW is 40.1 kDa.

  • All lanes : Anti-CD83 antibody [8A4C11] (ab233782) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human CD83 (aa 20-144)-hIgG-Fc-transfected HEK-293 cell lysate

    Predicted band size: 23 kDa

References

ab233782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up