Overview

  • Product name

  • Description

    Rabbit polyclonal to CD83
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD83 aa 85-137.
    Sequence:

    PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRK EET


    Database link: Q01151

  • Positive control

    • Human tonsil tissue. A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab205343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
  • Tissue specificity

    Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell activation 45kDa cell surface glycoprotein Ig superfamily antibody
    • B cell activation protein antibody
    • B-cell activation protein antibody
    • BL11 antibody
    • BL11 PEN antibody
    • CD83 antibody
    • CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) antibody
    • CD83 antigen antibody
    • CD83 molecule antibody
    • CD83_HUMAN antibody
    • Cell surface glycoprotein antibody
    • Cell surface protein HB15 antibody
    • HB15 antibody
    • hCD83 antibody
    see all

Images

  • Immunohistochemical analysis of human tonsil tissue labeling CD83 with ab205343 at 1/200 dilution.
  • Immunohistochemical analysis of human enometrium tissue labeling CD83 with ab205343 at 1/200 dilution.
  • Immunohistochemical analysis of human colon tissue labeling CD83 with ab205343 at 1/200 dilution.
  • Immunofluorescence analysis of formalin fixed, Triton X-100 permealized A431 cells, labeling CD83 with ab205343 at 4 µg/mL.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human tonsil tissue sections labeling CD83 with ab205343 at a 1/50 dilution.

References

This product has been referenced in:

  • Jiao Q  et al. Programmed death-1 ligands 1 and 2 expression in cutaneous squamous cell carcinoma and their relationship with tumour- infiltrating dendritic cells. Clin Exp Immunol 188:420-429 (2017). Read more (PubMed: 28052400) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up