For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    cd90--thy1-antibody-7e1b11-ab181469.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Adaptive Immunity T Cells CD
Share by email
Validated using a knockout cell line

Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

  • Datasheet
  • SDS
Reviews (3) Submit a question References (12)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
  • Immunocytochemistry/ Immunofluorescence - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

Key features and details

  • Mouse monoclonal [7E1B11] to CD90 / Thy1
  • Suitable for: WB, ICC/IF, IHC-P
  • Knockout validated
  • Reacts with: Rat, Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Kit
Product image
F-actin Staining Kit - Green Fluorescence - Cytopainter (ab112125)
Primary
Product image
Anti-CD105 antibody [SN6] (ab11414)
Primary
Product image
Anti-CD90 / Thy1 antibody [EPR3133] (ab133350)

View more associated products

Overview

  • Product name

    Anti-CD90 / Thy1 antibody [7E1B11]
    See all CD90 / Thy1 primary antibodies
  • Description

    Mouse monoclonal [7E1B11] to CD90 / Thy1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human, Recombinant fragment
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CD90/ Thy1 aa 17-132. (Expressed in E.coli).
    Sequence:

    SRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGT VGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPIS SQNVTVLRDKLVKCEG


    Database link: P04216
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate; Human CD90 / Thy1 recombinant protein; T47D, HepG2 and PC-12 cell lysates; HeLa cells; Human endometrial cancer and cerebellum tissues.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7E1B11
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Adaptive Immunity
    • T Cells
    • CD
    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Synapse marker
    • Stem Cells
    • Hematopoietic Progenitors
    • Lymphoid
    • B Lymphocytic Lineage
    • Stem Cells
    • Hematopoietic Progenitors
    • Lymphoid
    • T Lymphocytic Lineage
    • Stem Cells
    • Hematopoietic Progenitors
    • Myeloid
    • Monocytic Lineage

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Positive Controls

    • T-47D whole cell lysate (ab14899)
    • Hep G2 whole cell lysate (ab166833)
  • Recombinant Protein

    • Recombinant Human CD90 / Thy1 protein (Fc Chimera) (ab157072)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab181469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB (1)
1/500 - 1/2000. Predicted molecular weight: 17 kDa.
ICC/IF
1/200 - 1/1000.
IHC-P (2)
1/200 - 1/1000.
Notes
WB
1/500 - 1/2000. Predicted molecular weight: 17 kDa.
ICC/IF
1/200 - 1/1000.
IHC-P
1/200 - 1/1000.

Target

  • Function

    May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession P04216 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 7070 Human
    • Entrez Gene: 24832 Rat
    • Entrez Gene: 705321 Rhesus monkey
    • Omim: 188230 Human
    • SwissProt: P04216 Human
    • SwissProt: P01830 Rat
    • SwissProt: O62643 Rhesus monkey
    • Unigene: 644697 Human
    • Unigene: 108198 Rat
    see all
  • Alternative names

    • CD7 antibody
    • CD90 antibody
    • CD90 antigen antibody
    • CDw90 antibody
    • FLJ33325 antibody
    • MGC128895 antibody
    • T25 antibody
    • Theta antigen antibody
    • Thy 1 antibody
    • Thy 1 cell surface antigen antibody
    • Thy 1 membrane glycoprotein antibody
    • Thy 1 T cell antigen antibody
    • Thy 1.2 antibody
    • Thy-1 antigen antibody
    • Thy-1 membrane glycoprotein antibody
    • Thy1 antibody
    • Thy1 antigen antibody
    • Thy1 T cell antigen antibody
    • Thy1.1 antibody
    • Thy1.2 antibody
    • THY1_HUMAN antibody
    • Thymus cell antigen 1, theta antibody
    see all

Images

  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/2000 dilution

    Lane 1 : Wild-type U-2 OS cell lysate
    Lane 2 : THY1 knockout U-2 OS cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : PC-12 cell lysate
    Lane 5 : Human Brain cell lysate

    Lysates/proteins at 20 µg per lane.

    Performed under reducing conditions.

    Predicted band size: 17 kDa
    Observed band size: 35-50 kDa why is the actual band size different from the predicted?



    False colour image of Western blot: Anti-CD90 / Thy1 antibody [7E1B11] staining at 1/2000 dilution, shown in green; Rabbit anti-alpha Tubulin antibody [EP1332Y] (ab52866) loading control staining at 1/20000 dilution, shown in red. In Western blot, ab181469 was shown to bind specifically to CD90 / Thy1. A band was observed at 35-50 kDa in wild-type U-2 OS cell lysates with no signal observed at this size in Thy1 knockout cell line ab262490 (knockout cell lysate ab263925). To generate this image, wild-type and Thy1 knockout U-2 OS cell lysates were analysed. First, samples were run on an SDS-PAGE gel then transferred onto a nitrocellulose membrane. Membranes were blocked in 3 % milk in TBS-0.1 % Tween® 20 (TBS-T) before incubation with primary antibodies overnight at 4°C. Blots were washed four times in TBS-T, incubated with secondary antibodies for 1 h at room temperature, washed again four times then imaged. Secondary antibodies used were Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed (ab216772) and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed (ab216777) at 1/20000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

    Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.

  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution

    Lane 1 : T47D cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : PC-12 cell lysate

    Predicted band size: 17 kDa

  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution + CD90 / Thy1 recombinant protein

    Predicted band size: 17 kDa



    Expected MWt is 38.5 kDa.

  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution

    Lane 1 : Non-transfected HEK293 cell lysate
    Lane 2 : CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 17 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

    Immunohistochemical analysis of paraffin-embedded Human endometrial cancer tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.

  • Immunocytochemistry/ Immunofluorescence - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Immunocytochemistry/ Immunofluorescence - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

    Immunofluorescent analysis of HeLa cells labeling CD90 / Thy1 with ab181469 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

Protocols

  • Western blot protocols
  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (12)

Publishing research using ab181469? Please let us know so that we can cite the reference in this datasheet.

ab181469 has been referenced in 12 publications.

  • Chen L  et al. Simple application of adipose-derived stem cell-derived extracellular vesicles coating enhances cytocompatibility and osteoinductivity of titanium implant. Regen Biomater 8:rbaa038 (2021). PubMed: 33732487
  • Chen L  et al. The Apelin-Apelin Receptor Axis Triggers Cholangiocyte Proliferation and Liver Fibrosis During Mouse Models of Cholestasis. Hepatology 73:2411-2428 (2021). PubMed: 32964473
  • Luo B  et al. Engineering of a-PD-1 antibody-expressing long-lived plasma cells by CRISPR/Cas9-mediated targeted gene integration. Cell Death Dis 11:973 (2020). PubMed: 33184267
  • Jeong SY  et al. Fabrication of Dentin-Pulp-Like Organoids Using Dental-Pulp Stem Cells. Cells 9:N/A (2020). PubMed: 32155898
  • Liu Z  et al. CAF-induced placental growth factor facilitates neoangiogenesis in hepatocellular carcinoma. Acta Biochim Biophys Sin (Shanghai) 52:18-25 (2020). PubMed: 31828297
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-3 of 3 Abreviews or Q&A

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-CD90 / Thy1 antibody [7E1B11]

Below Average
Abreviews
Abreviews
abreview image
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (RA Synovium)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH 6 & TRIS pH 9
Permeabilization
Yes - 0.3% Triton X-100
Specification
RA Synovium
Blocking step
Donkey Serum 10% + 3% BSA as blocking agent for 24 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 4°C
Fixative
Paraformaldehyde
Read More

Dr. Dylan Windell

Verified customer

Submitted May 06 2022

Western blot abreview for Anti-CD90 / Thy1 antibody [7E1B11]

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Human Cell lysate - whole cell (fibroblast and brain)
Gel Running Conditions
Reduced Denaturing
Loading amount
25 µg
Specification
fibroblast and brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Read More

Abcam user community

Verified customer

Submitted Aug 23 2021

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-CD90 / Thy1 antibody [7E1B11]

Good
Abreviews
Abreviews
abreview image
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (colon)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: CC1
Permeabilization
No
Specification
colon
Fixative
Formaldehyde
Read More

Abcam user community

Verified customer

Submitted May 28 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.