Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
Key features and details
- Mouse monoclonal [7E1B11] to CD90 / Thy1
- Suitable for: WB, ICC/IF, IHC-P
- Knockout validated
- Reacts with: Rat, Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-CD90 / Thy1 antibody [7E1B11]
See all CD90 / Thy1 primary antibodies -
Description
Mouse monoclonal [7E1B11] to CD90 / Thy1 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human, Recombinant fragment
Predicted to work with: Rhesus monkey -
Immunogen
Recombinant fragment corresponding to Human CD90/ Thy1 aa 17-132. (Expressed in E.coli).
Sequence:SRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGT VGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPIS SQNVTVLRDKLVKCEG
Database link: P04216 -
Positive control
- CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate; Human CD90 / Thy1 recombinant protein; T47D, HepG2 and PC-12 cell lysates; HeLa cells; Human endometrial cancer and cerebellum tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7E1B11 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181469 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/2000. Predicted molecular weight: 17 kDa.
|
ICC/IF |
1/200 - 1/1000.
|
|
IHC-P | (2) |
1/200 - 1/1000.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 17 kDa. |
ICC/IF
1/200 - 1/1000. |
IHC-P
1/200 - 1/1000. |
Target
-
Function
May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 7070 Human
- Entrez Gene: 24832 Rat
- Entrez Gene: 705321 Rhesus monkey
- Omim: 188230 Human
- SwissProt: P04216 Human
- SwissProt: P01830 Rat
- SwissProt: O62643 Rhesus monkey
- Unigene: 644697 Human
see all -
Alternative names
- CD7 antibody
- CD90 antibody
- CD90 antigen antibody
see all
Images
-
All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/2000 dilution
Lane 1 : Wild-type U-2 OS cell lysate
Lane 2 : THY1 knockout U-2 OS cell lysate
Lane 3 : HepG2 cell lysate
Lane 4 : PC-12 cell lysate
Lane 5 : Human Brain cell lysate
Lysates/proteins at 20 µg per lane.
Performed under reducing conditions.
Predicted band size: 17 kDa
Observed band size: 35-50 kDa why is the actual band size different from the predicted?False colour image of Western blot: Anti-CD90 / Thy1 antibody [7E1B11] staining at 1/2000 dilution, shown in green; Rabbit anti-alpha Tubulin antibody [EP1332Y] (ab52866) loading control staining at 1/20000 dilution, shown in red. In Western blot, ab181469 was shown to bind specifically to CD90 / Thy1. A band was observed at 35-50 kDa in wild-type U-2 OS cell lysates with no signal observed at this size in Thy1 knockout cell line ab262490 (knockout cell lysate ab263925). To generate this image, wild-type and Thy1 knockout U-2 OS cell lysates were analysed. First, samples were run on an SDS-PAGE gel then transferred onto a nitrocellulose membrane. Membranes were blocked in 3 % milk in TBS-0.1 % Tween® 20 (TBS-T) before incubation with primary antibodies overnight at 4°C. Blots were washed four times in TBS-T, incubated with secondary antibodies for 1 h at room temperature, washed again four times then imaged. Secondary antibodies used were Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed (ab216772) and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed (ab216777) at 1/20000 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.
-
All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution
Lane 1 : T47D cell lysate
Lane 2 : HepG2 cell lysate
Lane 3 : PC-12 cell lysate
Predicted band size: 17 kDa -
Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution + CD90 / Thy1 recombinant protein
Predicted band size: 17 kDaExpected MWt is 38.5 kDa.
-
All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution
Lane 1 : Non-transfected HEK293 cell lysate
Lane 2 : CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 17 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
Immunohistochemical analysis of paraffin-embedded Human endometrial cancer tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.
-
Immunofluorescent analysis of HeLa cells labeling CD90 / Thy1 with ab181469 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (12)
ab181469 has been referenced in 12 publications.
- Chen L et al. Simple application of adipose-derived stem cell-derived extracellular vesicles coating enhances cytocompatibility and osteoinductivity of titanium implant. Regen Biomater 8:rbaa038 (2021). PubMed: 33732487
- Chen L et al. The Apelin-Apelin Receptor Axis Triggers Cholangiocyte Proliferation and Liver Fibrosis During Mouse Models of Cholestasis. Hepatology 73:2411-2428 (2021). PubMed: 32964473
- Luo B et al. Engineering of a-PD-1 antibody-expressing long-lived plasma cells by CRISPR/Cas9-mediated targeted gene integration. Cell Death Dis 11:973 (2020). PubMed: 33184267
- Jeong SY et al. Fabrication of Dentin-Pulp-Like Organoids Using Dental-Pulp Stem Cells. Cells 9:N/A (2020). PubMed: 32155898
- Liu Z et al. CAF-induced placental growth factor facilitates neoangiogenesis in hepatocellular carcinoma. Acta Biochim Biophys Sin (Shanghai) 52:18-25 (2020). PubMed: 31828297