Overview

  • Product name

  • Description

    Rabbit polyclonal to CD93
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD93 aa 227-493. N-terminal His-tag and GST-tag; Expressed in E.coli.
    Sequence:

    EGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCF EGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNY TCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPG GPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQ DVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGP PSGPPDEEDKGEKEGST


    Database link: Q9NPY3

  • Positive control

    • WB: HEK-293T cell lysate; Recombinant human CD93 protein. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Receptor (or element of a larger receptor complex) for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). May mediate the enhancement of phagocytosis in monocytes and macrophages upon interaction with soluble defense collagens. May play a role in intercellular adhesion.
  • Tissue specificity

    Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 5 EGF-like domains.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1q receptor 1 antibody
    • C1q/MBL/SPA receptor antibody
    • C1qR antibody
    • C1qR(p) antibody
    • C1qr1 antibody
    • C1QR1_HUMAN antibody
    • C1qRp antibody
    • CD93 antibody
    • CD93 antigen antibody
    • CD93 molecule antibody
    • CDw93 antibody
    • Complement component 1 q subcomponent receptor 1 antibody
    • Complement component C1q receptor antibody
    • dJ737E23.1 antibody
    • ECSM3 antibody
    • Matrix remodeling associated protein 4 antibody
    • Matrix remodelling associated 4 antibody
    • Matrix-remodeling-associated protein 4 antibody
    • MXRA4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CD93 using ab231945 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-CD93 antibody (ab231945) at 1 µg/ml + Recombinant human CD93 protein.
  • Anti-CD93 antibody (ab231945) at 1 µg/ml + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate.
  • Anti-CD93 antibody (ab231945) at 1 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

References

ab231945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up