Overview

  • Product name

  • Description

    Rabbit polyclonal to CD97
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment corresponding to Rat CD97 aa 191-304. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    KMGGYSCICRRGWKPAPGSPNGPVNTVCEDVDECSSGQHQCHSSAICKNI PGSYKCRCPPGWIAIPRDKPNNTVCQEPHFPTWTLLPTAHSQALLSFSVE VQNLLRDFNPATVN


    Database link: Q5XI36

  • Positive control

    • WB: Recombinant rat CD97 protein; rat serum. IHC-P: Rat kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 92 kDa.

Target

  • Function

    Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration.
  • Tissue specificity

    Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and pancreatic carcinomas too. Expression are increased under inflammatory conditions in the CNS of multiple sclerosis and in synovial tissue of patients with rheumatoid arthritis. Increased expression of CD97 in the synovium is accompagnied by detectable levels of soluble CD97 in the synovial fluid.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 5 EGF-like domains.
    Contains 1 GPS domain.
  • Domain

    The first two EGF domains mediate the interaction with DAF. A third tandemly arranged EGF domain is necessary for the structural integrity of the binding region.
    Binding to chondroitin sulfate is mediated by the fourth EGF domain.
  • Post-translational
    modifications

    Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADGRE5 antibody
    • Adhesion G protein-coupled receptor E5 antibody
    • CD 97 antibody
    • CD_antigen=CD97 antibody
    • CD97 antibody
    • CD97 antigen antibody
    • CD97 antigen subunit beta antibody
    • CD97 molecule antibody
    • CD97_HUMAN antibody
    • Leukocyte antigen CD97 antibody
    • Seven span transmembrane protein antibody
    • Seven transmembrane helix receptor antibody
    • Seven transmembrane heterodimeric receptor associated with inflammation antibody
    • TM7LN 1 antibody
    • TM7LN1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for CD97 using ab231196 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD97 antibody (ab231196) at 5 µg/ml + Rat serum

    Predicted band size: 92 kDa

  • Anti-CD97 antibody (ab231196) at 2 µg/ml + Recombinant rat CD97 protein

    Predicted band size: 92 kDa

References

ab231196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up