Overview

  • Product name

  • Description

    Rabbit polyclonal to CD99L2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CD99L2 aa 126-184.
    Sequence:

    DDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDD PGSGMVAEP


    Database link: Q8TCZ2

  • Positive control

    • IHC: Human bronchus and cerebral cortex tissue. WB: CD99L2 overexpression HEK-293T lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 28 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May function as a homophilic adhesion molecule. Functions in leukocyte-endothelial cell interactions during leukocyte extravasation, and in particular, at the diapedesis step. Does not seem to be involved in docking of leukocytes to the vessel wall or in lymphocyte diapedesis.
  • Tissue specificity

    Expressed in brain, heart, lung, liver, spleen, kidney, stomach, small intestine, skeletal muscle, ovary, thymus, testis and uterus. Lower expression seen in thymus. Expressed in E18 uterus and placenta.
  • Sequence similarities

    Belongs to the CD99 family.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Cell membrane. Cell junction.
  • Information by UniProt
  • Database links

  • Alternative names

    • C99L2_HUMAN antibody
    • CD99 antibody
    • CD99 antigen-like protein 2 antibody
    • CD99L2 antibody
    • MIC2-like protein 1 antibody
    • MIC2L1 antibody
    see all

Images

  • Paraffin-embedded human bronchus tissue stained for CD99L2 using ab224164 at 1/20 dilution in immunohistochemical analysis.

  • Negative control: Paraffin-embedded human tonsil tissue stained for CD99L2 using ab224164 at 1/20 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cereral cortex tissue stained for CD99L2 using ab224164 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-CD99L2 antibody (ab224164)

    Lane 1 : Vector only transfected HEK-293T(human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate (negative control)
    Lane 2 : CD99L2 overexpression HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 28 kDa

References

ab224164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up