Overview

  • Product name

    Anti-CDADC1 antibody
  • Description

    Rabbit polyclonal to CDADC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CDADC1 aa 295-395.
    Sequence:

    HFGFYRSNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVI WAEGKSRSCDGTGAMYFVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFR Y


    Database link: Q9BWV3

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May play an important role in testicular development and spermatogenesis.
  • Tissue specificity

    Widely expressed. Expressed at high levels in the testis.
  • Sequence similarities

    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA103J18.1 antibody
    • CDAC1_HUMAN antibody
    • CDADC1 antibody
    • cytidine and dCMP deaminase domain containing 1 antibody
    • Cytidine and dCMP deaminase domain-containing protein 1 antibody
    • MGC150615 antibody
    • MGC41774 antibody
    • MGC57136 antibody
    • NYD-SP15 antibody
    • OTTHUMP00000018405 antibody
    • protein kinase NYD-SP15 antibody
    • RP11-103J18.2 antibody
    • Testis development protein NYD-SP15 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for CDADC1 (green) using ab222217 at 4 µg/ml in ICC/IF.

References

ab222217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up