Overview

  • Product name

    Anti-Cdc20 antibody [AR12]
    See all Cdc20 primary antibodies
  • Description

    Mouse monoclonal [AR12] to Cdc20
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, Flow Cyt, ICC/IF, IP, IHC-Frmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein (His-tag) corresponding to Human Cdc20 aa 1-499. Urea-denatured His6 Cdc20 Human recombinant protein
    Sequence:

    MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH SAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ PENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKV LYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAV ALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEV QLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQT FTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLT MSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR


    Database link: Q12834

  • Positive control

    • Ramos or HeLa cells, Tonsil

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, PBS
  • Concentration information loading...
  • Purification notes

    200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G
  • Clonality

    Monoclonal
  • Clone number

    AR12
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IP Use at 1-0.5 µg/mg of lysate.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.

Target

  • Function

    Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1. In metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the WD repeat CDC20/Fizzy family.
    Contains 7 WD repeats.
  • Developmental stage

    Synthesis is initiated at G1/S, protein level peaks in M phase and protein is abruptly degraded at M/G1 transition.
  • Post-translational
    modifications

    Phosphorylated during mitosis, probably by maturation promoting factor (MPF). Phosphorylated by BUB1 at Ser-41; Ser-72; Ser-92; Ser-153; Thr-157 and Ser-161.
    Ubiquitinated and degraded by the proteasome during spindle assembly checkpoint. Deubiquitinated by USP44, leading to stabilize the MAD2L1-CDC20-APC/C ternary complex, thereby preventing premature activation of the APC/C.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA276H19.3 antibody
    • Cdc 20 antibody
    • CDC20 antibody
    • CDC20 cell division cycle 20 homolog antibody
    • CDC20_HUMAN antibody
    • CDC20A antibody
    • Cell division cycle 20 antibody
    • Cell division cycle 20 homolog (S. cerevisiae) antibody
    • Cell division cycle 20 homolog antibody
    • Cell division cycle protein 20 homolog antibody
    • fizzy antibody
    • MGC102824 antibody
    • p55CDC antibody
    see all

References

ab190711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up