Overview

  • Product name

    Anti-Cdc25A (phospho T507) antibody
    See all Cdc25A primary antibodies
  • Description

    Rabbit polyclonal to Cdc25A (phospho T507)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Cdc25A aa 481-524 (phospho T507) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL


    Database link: P30304

  • Positive control

    • Human lung carcinoma and mouse embryo tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

WB 1/100 - 1/1000. Predicted molecular weight: 59 kDa.

Target

  • Function

    Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDK1 and stimulates its kinase activity. Also dephosphorylates CDK2 in complex with cyclin E, in vitro.
  • Sequence similarities

    Belongs to the MPI phosphatase family.
    Contains 1 rhodanese domain.
  • Domain

    The phosphodegron motif mediates interaction with specific F-box proteins when phosphorylated. Putative phosphorylation sites at Ser-79 and Ser-82 appear to be essential for this interaction.
  • Post-translational
    modifications

    Phosphorylated by CHEK1 on Ser-76, Ser-124, Ser-178, Ser-279, Ser-293 and Thr-507 during checkpoint mediated cell cycle arrest. Also phosphorylated by CHEK2 on Ser-124, Ser-279, and Ser-293 during checkpoint mediated cell cycle arrest. Phosphorylation on Ser-178 and Thr-507 creates binding sites for YWHAE/14-3-3 epsilon which inhibits CDC25A. Phosphorylation on Ser-76, Ser-124, Ser-178, Ser-279 and Ser-293 may also promote ubiquitin-dependent proteolysis of CDC25A by the SCF complex. Phosphorylation of CDC25A at Ser-76 by CHEK1 primes it for subsequent phosphorylation at Ser-79, Ser-82 and Ser-88 by NEK11. Phosphorylation by NEK11 is required for BTRC-mediated polyubiquitination and degradation. Phosphorylation by PIM1 leads to an increase in phosphatase activity. Phosphorylated by PLK3 following DNA damage, leading to promote its ubiquitination and degradation.
    Ubiquitinated by the anaphase promoting complex/cyclosome (APC/C) ubiquitin ligase complex that contains FZR1/CDH1 during G1 phase leading to its degradation by the proteasome. Ubiquitinated by a SCF complex containing BTRC and FBXW11 during S phase leading to its degradation by the proteasome. Deubiquitination by USP17L2/DUB3 leads to its stabilization.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cdc 25a antibody
    • CDC25A antibody
    • CDC25A2 antibody
    • CDC25A2 CAG isoform antibody
    • Cell division cycle 25 homolog A (S. pombe) antibody
    • Cell division cycle 25A antibody
    • Cell division cycle 25A isoform a antibody
    • Cell division cycle 25A isoform b antibody
    • D9Ertd393e antibody
    • Dual specificity phosphatase Cdc25A antibody
    • M phase inducer phosphatase 1 antibody
    • M-phase inducer phosphatase 1 antibody
    • MGC115549 antibody
    • MPIP1_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human lung carcinoma tissue labeling Cdc25A (phospho T507) with ab203618 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse embryo tissue labeling Cdc25A (phospho T507) with ab203618 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

References

ab203618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up