Overview

  • Product name

  • Description

    Rabbit polyclonal to Cdc25C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human Cdc25C aa 290-340 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    CALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGG H


    Database link: P30307

  • Positive control

    • Mouse splenocytes; Mouse intestinal and testicular lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab217920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/50.
WB 1/100 - 1/1000. Detects a band of approximately 53 kDa (predicted molecular weight: 53 kDa).

Target

  • Function

    Functions as a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It directly dephosphorylates CDK1 and activate its kinase activity.
  • Sequence similarities

    Belongs to the MPI phosphatase family.
    Contains 1 rhodanese domain.
  • Developmental stage

    Expressed predominantly in G2 phase.
  • Post-translational
    modifications

    Phosphorylated by CHK1 on Ser-216. This phosphorylation creates a binding site for 14-3-3 protein and inhibits the phosphatase. Phosphorylated by PLK4.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDC 25 antibody
    • Cdc 25C antibody
    • CDC25 antibody
    • CDC25C antibody
    • Cell division cycle 25 homolog C antibody
    • Cell division cycle 25C antibody
    • Cell division cycle 25C protein antibody
    • Dual specificity phosphatase Cdc25C antibody
    • M phase inducer phosphatase 3 antibody
    • M-phase inducer phosphatase 3 antibody
    • Mitosis inducer CDC25 antibody
    • MPIP3 antibody
    • MPIP3_HUMAN antibody
    • Phosphotyrosine phosphatase antibody
    • PPP1R60 antibody
    • protein phosphatase 1, regulatory subunit 60 antibody
    see all

Images

  • All lanes : Anti-Cdc25C antibody (ab217920) at 1/300 dilution

    Lane 1 : Mouse intestinal lysate
    Lane 2 : Mouse testicular lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/5000 dilution

    Predicted band size: 53 kDa
    Observed band size: 53 kDa



    10% SDS-PAGE gel.

  • Flow cytometric analysis of mouse splenocytes labeling Cdc25C with ab217920 at 1/50 dilution for 30 minutes (green) followed by a FITC conjugated secondary antibody, compared to unstained cells (blue), secondary only (light blue) and isotype control(orange).

References

ab217920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up