Overview

  • Product name

  • Description

    Rabbit polyclonal to Cdc37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, ICC/IFmore details
  • Species reactivity

    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Recombinant full length protein corresponding to Saccharomyces cerevisiae Cdc37 aa 1-506. (Expressed in E. coli).
    Sequence:

    MAIDYSKWDKIELSDDSDVEVHPNVDKKSFIKWKQQSIHEQRFKRNQDIK NLETQVDMYSHLNKRVDRILSNLPESSLTDLPAVTKFLNANFDKMEKSKG ENVDPEIATYNEMVEDLFEQLAKDLDKEGKDSKSPSLIRDAILKHRAKID SVTVEAKKKLDELYKEKNAHISSEDIHTGFDSSFMNKQKGGAKPLEATPS EALSSAAESNILNKLAKSSVPQTFIDFKDDPMKLAKETEEFGKISINEYS KSQKFLLEHLPIISEQQKDALMMKAFEYQLHGDDKMTLQVIHQSELMAYI KEIYDMKKIPYLNPMELSNVINMFFEKVIFNKDKPMGKESFLRSVQEKFL HIQKRSKILQQEEMDESNAEGVETIQLKSLDDSTELEVNLPDFNSKDPEE MKKVKVFKTLIPEKMQEAIMTKNLDNINKVFEDIPIEEAEKLLEVFNDID IIGIKAILENEKDFQSLKDQYEQDHEDATMENLSLNDRDGGGDNHEEVKH TADTVD


    Database link: P06101

  • Positive control

    • S. cerevisiae cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab188280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 58 kDa.
IP Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity.
  • Sequence similarities

    Belongs to the CDC37 family.
  • Post-translational
    modifications

    Constitutively sumoylated by UBE2I.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

    • Alternative names

      • CDC 37 antibody
      • Cdc37 antibody
      • CDC37 cell division cycle 37 homolog antibody
      • CDC37 cell division cycle 37 S cerevisiae homolog antibody
      • CDC37 cell division cycle 37, S cerevisiae, homolog of antibody
      • Cdc37 homolog antibody
      • CDC37 protein antibody
      • CDC37_HUMAN antibody
      • CDC37A antibody
      • cell division cycle 37 antibody
      • Cell division cycle 37 homolog antibody
      • Hsp90 chaperone protein kinase targeting subunit antibody
      • Hsp90 chaperone protein kinase targeting subunit p50Cdc37 antibody
      • Hsp90 chaperone protein kinase-targeting subunit antibody
      • Hsp90 co chaperone Cdc37 antibody
      • Hsp90 co-chaperone Cdc37 antibody
      • p50 antibody
      • p50Cdc37 antibody
      • S cerevisiae hypothetical protein CDC37 antibody
      see all

    Images

    • Lane 1 : Anti-Cdc37 antibody (ab188280) at 1/1000 dilution
      Lane 2 : Anti-Cdc37 antibody (ab188280) at 1/5000 dilution

      All lanes : S. cerevisiae cell extract

      Predicted band size: 58 kDa
      Observed band size: 68 kDa
      why is the actual band size different from the predicted?

    References

    ab188280 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab188280.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up