Overview

  • Product name

    Anti-CDC42 antibody [M430]
    See all CDC42 primary antibodies
  • Description

    Mouse monoclonal [M430] to CDC42
  • Host species

    Mouse
  • Specificity

    ab202280 does not recognize a full length human RhoA GST fusion protein.
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow, Dog, Pig, Drosophila melanogaster, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Rat CDC42 aa 1-191.
    Sequence:

    MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEP YTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPE ITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLK AVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL


    Database link: Q8CFN2

  • Positive control

    • Jurkat cells and mouse brain lysates; rat A7r5 cells; recombinant full length rat Cdc42 fusion protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab202280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 21 kDa.
ICC/IF 1/200.

Target

  • Function

    Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Causes the formation of thin, actin-rich surface projections called filopodia.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family. CDC42 subfamily.
  • Post-translational
    modifications

    AMPylation at Tyr-32 and Thr-35 are mediated by bacterial enzymes in case of infection by H.somnus and V.parahaemolyticus, respectively. AMPylation occurs in the effector region and leads to inactivation of the GTPase activity by preventing the interaction with downstream effectors, thereby inhibiting actin assembly in infected cells. It is unclear whether some human enzyme mediates AMPylation; FICD has such ability in vitro but additional experiments remain to be done to confirm results in vivo.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing. Isoform 1 also known as: Brain; Isoform 2 also known as: Placental.
  • Alternative names

    • CDC42 antibody
    • CDC42_HUMAN antibody
    • CDC42Hs antibody
    • Cell division control protein 42 homolog antibody
    • Cell division cycle 42 (GTP binding protein 25kDa) antibody
    • Cell division cycle 42 antibody
    • dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)) antibody
    • dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD)) antibody
    • G25K antibody
    • G25K GTP-binding protein antibody
    • Growth regulating protein antibody
    • GTP binding protein 25kDa antibody
    • Small GTP binding protein CDC42 antibody
    • TKS antibody
    see all

Images

  • Lane 1: Wild-type HAP1 cell lysate (20 µg)
    Lane 2: CDC42 knockout HAP1 cell lysate (20 µg)
    Lane 3: MCF7 cell lysate (20 µg)
    Lane 4: HepG2 cell lysate (20 µg)
    Lanes 1 - 4: Merged signal (red and green). Green - ab202280 observed at 20 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab202280 was shown to recognize CDC42 in wild-type HAP1 cells along with additional cross-reactive bands. No band was observed when CDC42 knockout samples were examined. Wild-type and CDC42 knockout samples were subjected to SDS-PAGE. ab202280 and ab181602 (loading control to GAPDH) were diluted at 1/500 and 1/10,000 respectively and incubated overnight at 4°C. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed ab216772 and Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed ab216777 secondary antibodies at 1/10,000 dilution for 1 hour at room temperature before imaging.

  • All lanes : Anti-CDC42 antibody [M430] (ab202280) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : mouse brain lysate
    Lane 3 : Recombiant full length rat Cdc42 protein

    Predicted band size: 21 kDa

  • Immunofluorescence analysis of paraformaldehyde-fixed rat A7r5 cells, labeling CDC42 using ab202280 at a 1/200 dilution, in the absence (left, black protein block) or presence (right, red image) of full length Cdc42 recombinant protein. Goat anti-mouse conjugated to DyLight® 594 was used as secondary antibody.

References

ab202280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up