Overview

  • Product name

    Anti-CDC42EP3 antibody
  • Description

    Rabbit polyclonal to CDC42EP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CDC42EP3 aa 1-226.
    Sequence:

    MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQH DVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPS PVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVME EKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWP AEDMFDHPTPCELIKGKTKSEESLSD


    Database link: Q9UKI2

  • Positive control

    • IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    CDC42EP3 is probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. It induces pseudopodia formation in fibroblasts.
  • Cellular localization

    Endomembrane system; Peripheral membrane protein. Cytoplasm; cytoskeleton.
  • Database links

  • Alternative names

    • Binder of Rho GTPases 2 antibody
    • BORG2 antibody
    • CDC42 effector protein (Rho GTPase binding) 3 antibody
    • Cdc42 effector protein 3 antibody
    • CEP3 antibody
    • CRIB containing BORG2 protein antibody
    • MSE55 related Cdc42 binding protein antibody
    • MSE55 related protein antibody
    • UB1 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for CDC42EP3 using ab229808 at 1/100 dilution in immunohistochemical analysis.

References

ab229808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up