Overview

  • Product name

  • Description

    Rabbit polyclonal to CDCA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human CDCA2 aa 373-410 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    AEDEENFEAPAFLNMRKRKRVTFGEDLSPEVFDESLPA


    Database link: Q69YH5-1

  • Positive control

    • Human gastric carcinoma tissue.
  • General notes

     This product was previously labelled as CDCA2, CDCA2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab214289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    CDCA2 is a regulator of chromosome structure during mitosis. It is required for condensin-depleted chromosomes to retain their compact architecture through anaphase. It acts by mediating the recruitment of phosphatase PP1-gamma subunit (PPP1CC) to chromatin at anaphase and into the following interphase. At anaphase onset, its association with chromatin targets a pool of PPP1CC to dephosphorylate substrates. CDCA2 is essential for cell viability.
  • Cellular localization

    Nuclear. Excluded from the nucleolus. Present in nucleoplasm throughout the G1, S and G2 stages of the cell cycle. During M phase, it becomes diffuse throughout the cell as the nuclear membrane breaks down, and faintly accumulates later on metaphase chromatin. As the cell progresses to anaphase, it accumulates on chromatin.
  • Database links

  • Alternative names

    • CDCA 2 antibody
    • Cell division cycle associated protein 2 antibody
    • PPP1R81 antibody
    • protein phosphatase 1, regulatory subunit 81 antibody
    • Recruits PP1 onto mitotic chromatin at anaphase protein antibody
    • Repo Man antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human gastric carcinoma tissue, labeling CDCA2 with ab214289 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up