Overview

  • Product name

    Anti-CDCA7 antibody
  • Description

    Rabbit polyclonal to CDCA7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CDCA7 aa 51-128.
    Sequence:

    PKFRSDISEELANVFYEDSDNESFCGFSESEVQDVLDHCGFLQKPRPDVT NELAGIFHADSDDESFCGFSESEIQDGM


    Database link: Q9BWT1-2

  • Positive control

    • ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    CDCA7 is a nuclear protein without a known function, although its high homology with the transcription factor JPO2 or RAM2 suggests that it is also a transcription factor. CDCA7 is one of many target genes regulated by the c-Myc transcription factor. Overexpression of CDCA7 occurs in a significant proportion of cancers and it may play an important role in tumorigenesis. Normally it is periodically expressed in the cell cycle, peaking at the G1 to S phase transition.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • CDCA7 antibody
    • Cell division cycle associated 7 antibody
    • JPO1 antibody

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human bone osteosarcoma epithelial cell line) cells stained for CDCA7 (green) using ab223717 at 4 µg/ml in ICC/IF.

References

ab223717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up