Overview

  • Product name

  • Description

    Rabbit polyclonal to CDCP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CDCP1 aa 208-354.
    Sequence:

    GFSIANRSSIKRLCIIESVFEGEGSATLMSANYPEGFPEDELMTWQFVVP AHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDKQPGNMAG NFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERA


    Database link: Q9H5V8

  • Positive control

    • IHC-P: Human esophagus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in cell adhesion and cell matrix association. May play a role in the regulation of anchorage versus migration or proliferation versus differentiation via its phosphorylation. May be a novel marker for leukemia diagnosis and for immature hematopoietic stem cell subsets. Belongs to the tetraspanin web involved in tumor progression and metastasis.
  • Tissue specificity

    Highly expressed in mitotic cells with low expression during interphase. Detected at highest levels in skeletal muscle and colon with lower levels in kidney, small intestine, placenta and lung. Up-regulated in a number of human tumor cell lines, as well as in colorectal cancer, breast carcinoma and lung cancer. Also expressed in cells with phenotypes reminiscent of mesenchymal stem cells and neural stem cells.
  • Sequence similarities

    Contains 1 CUB domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine by kinases of the SRC family such as SRC and YES as well as by the protein kinase C gamma/PRKCG. Dephosphorylated by phosphotyrosine phosphatases. Also phosphorylated by suramin, a heparin analog. Tyrosine phosphorylated in response to dissociation of integrin alpha-6 beta-4 from laminin-5.
    N-glycosylated.
    A soluble form may also be produced by proteolytic cleavage at the cell surface (shedding). Another peptide of 80 kDa (p80) is present in cultured keratinocytes probably due to tryptic cleavage at an unidentified site on its N-terminal side. Converted to p80 by plasmin, a trypsin-like protease.
  • Cellular localization

    Secreted and Cell membrane. Shedding may also lead to a soluble peptide.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9030022E12Rik antibody
    • AA409659 antibody
    • CD 318 antibody
    • CD_antigen=CD318 antibody
    • CD318 antibody
    • CD318 antigen antibody
    • CDCP 1 antibody
    • Cdcp1 antibody
    • CDCP1_HUMAN antibody
    • CUB domain containing protein 1 antibody
    • CUB domain-containing protein 1 antibody
    • E030027H19Rik antibody
    • FLJ13772 antibody
    • FLJ22375 antibody
    • FLJ22969 antibody
    • Membrane glycoprotein gp140 antibody
    • MGC31813 antibody
    • OTTHUMP00000164120 antibody
    • OTTHUMP00000209568 antibody
    • RGD1305578 antibody
    • SIMA 135 antibody
    • SIMA135 antibody
    • Subtractive immunization M plus HEp3 associated 135 kDa protein antibody
    • Subtractive immunization M plus HEp3-associated 135 kDa protein antibody
    • Transmembrane and associated with src kinases antibody
    • TRASK antibody
    see all

Images

  • Paraffin-embedded human esophagus tissue stained for CDCP1 using ab223743 at 1/50 dilution in immunohistochemical analysis.

References

ab223743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up