Overview

  • Product name

    Anti-CDK11/CDC2L2/CDK11A antibody
    See all CDK11/CDC2L2/CDK11A primary antibodies
  • Description

    Rabbit polyclonal to CDK11/CDC2L2/CDK11A
  • Host species

    Rabbit
  • Specificity

    The immunogen displays 95% identity to CDK11/CDC2L2/CDK11A and is predicted to react with this protein as well as with CDK11A.

  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CDK11/CDC2L2/CDK11A aa 67-167.
    Sequence:

    YRREDSMEDRGEEDDSLAIKPPQQMSWKEKVHHRKDEKRKEKCRHHSHSA EGGKHARVKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRL E


    Database link: Q9UQ88

  • Positive control

    • IHC-P: Human duodenum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression.
  • Tissue specificity

    Expressed ubiquitously. Some evidence of isoform-specific tissue distribution.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    During apoptosis, induced by Fas or tumor necrosis factor, specific CKD11 p110 isoforms are cleaved by caspases to produce a protein (p110C) that contains the C-terminal kinase domain of the CDK11 proteins.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD11A_HUMAN antibody
    • CDC2L2 antibody
    • CDC2L3 antibody
    • CDK11 antibody
    • CDK11 p110 antibody
    • CDK11 p46 antibody
    • CDK11 p58 antibody
    • CDK11A antibody
    • Cell division cycle 2 like 2 (PITSLRE proteins) antibody
    • Cell division cycle 2-like protein kinase 2 antibody
    • Cell division protein kinase 11A antibody
    • Cyclin-dependent kinase 11A antibody
    • Galactosyltransferase-associated protein kinase p58/GTA antibody
    • p58GTA antibody
    • PITSLRE antibody
    • PITSLRE B antibody
    • PITSLRE protein kinase beta antibody
    • PITSLRE serine/threonine-protein kinase CDC2L2 antibody
    • PITSLREB antibody
    see all

Images

  • Paraffin embedded human duodenum tissue stained for CDK11/CDC2L2/CDK11A with ab223730 (1/50 dilution) in immunohistochemical analysis.

References

ab223730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up