Overview

  • Product name

  • Description

    Rabbit polyclonal to Cdk2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow, Chinese hamster
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Cdk2 aa 94-198. Expressed in E.coli. N-terminal tag.
    Sequence:

    SALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKL ADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIF AEMVT


    Database link: P24941

  • Positive control

    • IHC-P: Human liver, liver cancer, breast cancer and colorectal cancer tissues. WB: HeLa, HepG2 and K562 cell lysates; Pig liver lysate; Recombinant human Cdk2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 34 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • All lanes : Anti-Cdk2 antibody (ab232753) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 4 : Pig liver lysate

    Predicted band size: 34 kDa

  • Paraffin-embedded human liver tissue stained for Cdk2 using ab232753 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for Cdk2 using ab232753 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for Cdk2 using ab232753 at 20 µg/ml in immunohistochemical analysis, followed by HRP-Linked Goat Anti-Rabbit IgG Polyclonal Antibody at 2 µg/ml. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for Cdk2 using ab232753 at 20 µg/ml in immunohistochemical analysis, followed by HRP-Linked Goat Anti-Rabbit IgG Polyclonal Antibody at 2 µg/ml. DAB staining.

  • Anti-Cdk2 antibody (ab232753) at 2 µg/ml + Recombinant human Cdk2 protein

    Predicted band size: 34 kDa

References

ab232753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up