Overview

  • Product name

    Anti-CDKA1 / DOC1 antibody
    See all CDKA1 / DOC1 primary antibodies
  • Description

    Rabbit polyclonal to CDKA1 / DOC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Hamster
  • Immunogen

    Recombinant full length protein corresponding to Human CDKA1/ DOC1 aa 1-115. NP_004633.1.
    Sequence:

    MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYT QGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARG LVRECLAETERNARS


    Database link: O14519

  • Positive control

    • Human small intestine and kidney tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB Use at an assay dependent concentration. Predicted molecular weight: 12 kDa.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling CDKA1 / DOC1 with ab211426 at 10µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling CDKA1 / DOC1 with ab211426 at 10µg/ml.

References

ab211426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up