Overview

  • Product name

  • Description

    Rabbit polyclonal to CDKL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CDKL5 aa 636-758.
    Sequence:

    AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGV YHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTR VSSLPSESSSGTNHSKRQPAFDP


    Database link: O76039

  • Positive control

    • IHC: Human colon tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mediates phosphorylation of MECP2.
  • Tissue specificity

    Expressed in brain, lung, kidney, prostate, ovary, placenta, pancreas and testis.
  • Involvement in disease

    Note=Chromosomal aberrations involving CDKL5 are found in patients manifesting early-onset seizures and spams and psychomotor impairment. Translocation t(X;6)(p22.3;q14); translocation t(X;7)(p22.3;p15).
    Defects in CDKL5 are a cause of epileptic encephalopathy early infantile type 2 (EIEE2) [MIM:300672]; also known as atypical CDKL5-related Rett syndrome. EIEE2 is a severe form of epilepsy characterized by seizures or spasms beginning in infancy. Patients manifest features resembling Rett syndrome such as microcephaly, lack of speech development, stereotypic hand movements.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cdkl5 antibody
    • CDKL5_HUMAN antibody
    • Cyclin dependent kinase 5 transcript antibody
    • Cyclin-dependent kinase-like 5 antibody
    • EIEE2 antibody
    • ISSX antibody
    • Serine/threonine kinase 9 antibody
    • Serine/threonine-protein kinase 9 antibody
    • Stk9 antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for CDKL5 using ab224052 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for CDKL5 (green) using ab224052 at 4 µg/ml in ICC/IF.

References

ab224052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up