Overview

  • Product name
    Anti-CDKN1A interacting zinc finger protein 1 antibody
    See all CDKN1A interacting zinc finger protein 1 primary antibodies
  • Description
    Mouse polyclonal to CDKN1A interacting zinc finger protein 1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CDKN1A interacting zinc finger protein 1 aa 1-818. (AAH21163.1)
    Sequence:

    MFSQQQQQQLQQQQQQLQQLQQQQLQQQQLQQQQLLQLQQLLQQSPPQAP LPMAVSRGLPPQQPQQPLLNLQGTNSASLLNGSMLQRALLLQQLQGNLRG YGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQF NLSGRNPQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMD TPEDQDLPPCPEDIAKEKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPP GQLQVKAQPQARMTVPKQTQTPDLLPEALEAQVLPRFQPRVLQVQAQVQS QTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQVQPQLQQEAEPQKQ VQPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTP VVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGE CENRAREMPGVWGAGGSLKVTILQSSDSRAFSTVPLTPVPRPSDSVSSTP AATSTPSKQALQFFCYICKASCSSQQEFQDHMSEPQHQQRLGEIQHMSQA CLLSLLPVPRDVLETEDEEPPPRRWCNTCQLYYMGDLIQHRRTQDHKIAK QSLRPFCTVCNRYFKTPRKFVEHVKSQGHKDKAKELKSLEKEIAGQDEDH FITVDAVGCFEGDEEEEEDDEDEEEIEVEEELCKQVRSRDISREEWKGSE TYSPNTAYGVDFLVPVMGYICRICHKFYHSNSGAQLSHCKSLGHFENLQK YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV TARPSQPPLPRRSTRLKT


    Database link: Q9ULV3-3

  • Positive control
    • CDKN1A interacting zinc finger protein 1 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 91 kDa.

Target

  • Function
    May regulate the subcellular localization of CIP/WAF1.
  • Involvement in disease
    Defects in CIZ1 may be a cause of adult onset primary cervical dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Cervical dystonia or spasmodic torticollis, the most common form of focal dystonia, is characterized by involuntary contractions of the neck muscles, which produce abnormal posturing of the head upon the trunk.
  • Sequence similarities
    Contains 1 matrin-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CDKI antibody
    • CDKN1A-interacting zinc finger protein 1 antibody
    • Cip1-interacting zinc finger protein antibody
    • CIZ1 antibody
    • CIZ1_HUMAN antibody
    • cyclin dependent inhibitor 1A antibody
    • LSFR1 antibody
    • Melanoma differentiation-associated protein antibody
    • NP94 antibody
    • Nuclear protein NP94 antibody
    • OPHN3 antibody
    • P21 antibody
    • Zinc finger protein 356 antibody
    • ZNF356 antibody
    see all

Images

  • All lanes : Anti-CDKN1A interacting zinc finger protein 1 antibody (ab172442) at 1 µg/ml

    Lane 1 : CDKN1A interacting zinc finger protein 1 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 91 kDa

References

This product has been referenced in:
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up