Overview

  • Product name

    Anti-CDKN1A interacting zinc finger protein 1/CIZ1 antibody
    See all CDKN1A interacting zinc finger protein 1/CIZ1 primary antibodies
  • Description

    Mouse polyclonal to CDKN1A interacting zinc finger protein 1/CIZ1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CDKN1A interacting zinc finger protein 1/CIZ1 aa 1-818. (AAH21163.1)
    Sequence:

    MFSQQQQQQLQQQQQQLQQLQQQQLQQQQLQQQQLLQLQQLLQQSPPQAP LPMAVSRGLPPQQPQQPLLNLQGTNSASLLNGSMLQRALLLQQLQGNLRG YGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQF NLSGRNPQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMD TPEDQDLPPCPEDIAKEKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPP GQLQVKAQPQARMTVPKQTQTPDLLPEALEAQVLPRFQPRVLQVQAQVQS QTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQVQPQLQQEAEPQKQ VQPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTP VVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGE CENRAREMPGVWGAGGSLKVTILQSSDSRAFSTVPLTPVPRPSDSVSSTP AATSTPSKQALQFFCYICKASCSSQQEFQDHMSEPQHQQRLGEIQHMSQA CLLSLLPVPRDVLETEDEEPPPRRWCNTCQLYYMGDLIQHRRTQDHKIAK QSLRPFCTVCNRYFKTPRKFVEHVKSQGHKDKAKELKSLEKEIAGQDEDH FITVDAVGCFEGDEEEEEDDEDEEEIEVEEELCKQVRSRDISREEWKGSE TYSPNTAYGVDFLVPVMGYICRICHKFYHSNSGAQLSHCKSLGHFENLQK YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV TARPSQPPLPRRSTRLKT


    Database link: Q9ULV3-3

  • Positive control

    • CDKN1A interacting zinc finger protein 1/CIZ1 transfected 293T cell lysate
  • General notes

     This product was previously labelled as CDKN1A interacting zinc finger protein 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab172442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 91 kDa.

Target

  • Function

    May regulate the subcellular localization of CIP/WAF1.
  • Involvement in disease

    Defects in CIZ1 may be a cause of adult onset primary cervical dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Cervical dystonia or spasmodic torticollis, the most common form of focal dystonia, is characterized by involuntary contractions of the neck muscles, which produce abnormal posturing of the head upon the trunk.
  • Sequence similarities

    Contains 1 matrin-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDKI antibody
    • CDKN1A-interacting zinc finger protein 1 antibody
    • Cip1-interacting zinc finger protein antibody
    • CIZ1 antibody
    • CIZ1_HUMAN antibody
    • cyclin dependent inhibitor 1A antibody
    • LSFR1 antibody
    • Melanoma differentiation-associated protein antibody
    • NP94 antibody
    • Nuclear protein NP94 antibody
    • OPHN3 antibody
    • P21 antibody
    • Zinc finger protein 356 antibody
    • ZNF356 antibody
    see all

Images

  • All lanes : Anti-CDKN1A interacting zinc finger protein 1/CIZ1 antibody (ab172442) at 1 µg/ml

    Lane 1 : CDKN1A interacting zinc finger protein 1/CIZ1 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 91 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up