For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    cdkn2ap16ink4a-antibody-dcs501-ab16123.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Cell Cycle Cell Cycle Inhibitors Ink4
Share by email

Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

  • Datasheet
  • SDS
Reviews (2)Q&A (10)References (6)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
  • Western blot - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
  • Immunocytochemistry/ Immunofluorescence - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
  • Flow Cytometry - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

Key features and details

  • Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a
  • Suitable for: ICC/IF, IHC-P, WB, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Primary
Product image
Anti-CDKN2A/p16INK4a antibody [EPR20418] (ab211542)
Primary
Product image
Anti-p21 antibody [CIP1/823] - BSA and Azide free (ab212247)

View more associated products

Overview

  • Product name

    Anti-CDKN2A/p16INK4a antibody [DCS50.1]
    See all CDKN2A/p16INK4a primary antibodies
  • Description

    Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a
  • Host species

    Mouse
  • Specificity

    This antibody shows no cross reactivity with the closely related inhibitors p15INK4b and p18INK4c.
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CDKN2A/p16INK4a aa 1-156.
    Sequence:

    MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG PSDIPD


    Database link: P42771
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293 and HeLa cell lysates; Flow cyt: HEK-293 cells; IHC-P: Bladder tumor tissue, HPV-infected preneoplastic lesion in human uterine cervix; ICC/IF: Hepp cells.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.08% Sodium azide
    Constituent: 99.9% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    DCS50.1
  • Isotype

    IgG1
  • Research areas

    • Cell Biology
    • Cell Cycle
    • Cell Cycle Inhibitors
    • Ink4
    • Epigenetics and Nuclear Signaling
    • Cell cycle
    • Cell Cycle Inhibitors
    • Ink4
    • Cancer
    • Cell cycle
    • Cell cycle inhibitors
    • Ink4
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • INK4a/Arf

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
  • Conjugation kits

    • PE / R-Phycoerythrin Conjugation Kit - Lightning-Link® (ab102918)
    • APC Conjugation Kit - Lightning-Link® (ab201807)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
    • Mouse IgG1, Kappa Monoclonal [B11/6] - Isotype Control (ab91353)
  • Recombinant Protein

    • Recombinant Human CDKN2A/p16INK4a protein (ab84075)
  • Related Products

    • Recombinant Human CDKN2A/p16INK4a protein (ab84075)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab16123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF
Use a concentration of 1 µg/ml.
IHC-P
Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
WB (1)
Use at an assay dependent concentration. Detects a band of approximately 16 kDa (predicted molecular weight: 16 kDa).
Flow Cyt
Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Notes
ICC/IF
Use a concentration of 1 µg/ml.
IHC-P
Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
WB
Use at an assay dependent concentration. Detects a band of approximately 16 kDa (predicted molecular weight: 16 kDa).
Flow Cyt
Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Target

  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

    • Entrez Gene: 1029 Human
    • Omim: 600160 Human
    • SwissProt: P42771 Human
    • Form

      There are 4 isoforms produced by alternative splicing. Isoform 1 also known as: p16INK4a; Isoform 3 also known as: p12; Isoform 4 also known as: p14ARF; p19ARF; ARF.
    • Alternative names

      • CCM2 antibody
      • CDK4 inhibitor p16 INK4 antibody
      • CDK4I antibody
      • CDKN2 antibody
      • CDKN2A antibody
      • Cell cycle negative regulator beta antibody
      • CMM2 antibody
      • Cyclin dependent kinase 4 inhibitor A antibody
      • Cyclin dependent kinase inhibitor 2A (melanoma p16 inhibits CDK4) antibody
      • Cyclin Dependent Kinase Inhibitor 2A antibody
      • Cyclin dependent kinase inhibitor 2A isoform 4 antibody
      • Cyclin dependent kinase inhibitor 2A isoforms 1/2/3 antibody
      • Cyclin dependent kinase inhibitor p16 antibody
      • INK4 antibody
      • INK4A antibody
      • MLM antibody
      • MTS1 antibody
      • Multiple tumor suppressor 1 antibody
      • p14 antibody
      • p16 antibody
      • P16INK4 antibody
      • p16INK4a antibody
      • p19 antibody
      • p19Arf antibody
      • TP16 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded, HPV-infected, preneoplastic lesion in human uterine cervix tissue labelling CDKN2A/p16INK4a with ab16123. Antigen retreival was performed with Tris/EDTA buffer pH 9.

    • Western blot - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
      Western blot - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
      All lanes : Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123) at 1 µg/ml

      Lane 1 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate
      Lane 2 : HEK293 (Human embryonic kidney cell line) Whole Cell Lysate

      Lysates/proteins at 10 µg per lane.

      Secondary
      All lanes : Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution

      Developed using the ECL technique.

      Performed under reducing conditions.

      Predicted band size: 16 kDa
      Observed band size: 16 kDa
      Additional bands at: 37 kDa, 50 kDa. We are unsure as to the identity of these extra bands.


      Exposure time: 12 minutes
    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded bladder tumor tissue labelling CDKN2A/p16INK4a with ab16123 at 10µg/ml.

    • Immunocytochemistry/ Immunofluorescence - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
      Immunocytochemistry/ Immunofluorescence - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

      ICC/IF image of ab16123 stained Hepp cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    • Flow Cytometry - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
      Flow Cytometry - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)

      Overlay histogram showing HEK293 cells stained with ab16123 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/1x106 cells ) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol used under the same conditions.

      Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.

    Protocols

    • Flow cytometry protocols
    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols
    • Protocol Booklet

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (6)

    Publishing research using ab16123? Please let us know so that we can cite the reference in this datasheet.

    ab16123 has been referenced in 6 publications.

    • Göbl C  et al. Cysteine oxidation triggers amyloid fibril formation of the tumor suppressor p16INK4A. Redox Biol 28:101316 (2020). PubMed: 31539802
    • Yang C  et al. Study of the cytological features of bone marrow mesenchymal stem cells from patients with neuromyelitis optica. Int J Mol Med 43:1395-1405 (2019). PubMed: 30628649
    • Kannappan R  et al. p53 Modulates the Fate of Cardiac Progenitor Cells Ex Vivo and in the Diabetic Heart In Vivo. EBioMedicine 16:224-237 (2017). PubMed: 28163043
    • Fernández-Torrón R  et al. Cancer risk in DM1 is sex-related and linked to miRNA-200/141 downregulation. Neurology 87:1250-7 (2016). PubMed: 27558368
    • Capell BC  et al. MLL1 is essential for the senescence-associated secretory phenotype. Genes Dev 30:321-36 (2016). PubMed: 26833731
    • Dou Z  et al. Autophagy mediates degradation of nuclear lamina. Nature 527:105-9 (2015). WB ; Human . PubMed: 26524528

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review

    Filter by Application

    Filter by Species

    Filter by Ratings

    1-2 of 2 Abreviews

    ELISA abreview for Anti-CDKN2A/p16INK4a [DCS50.1] antibody

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    ELISA
    Sample
    Human Recombinant protein (Purified recombinant p16 (overexpressed in HEK293))
    Specification
    Purified recombinant p16 (overexpressed in HEK293)
    Type
    Sandwich (Capture)
    Blocking step
    SuperBlock PBS Pierce #37580 as blocking agent for 12 hour(s) and 0 minute(s) · Concentration: 10µg/mL
    Read More

    Abcam user community

    Verified customer

    Submitted Apr 28 2014

    Western blot abreview for Anti-CDKN2A/p16INK4a antibody [DCS50.1]

    Average
    Abreviews
    Abreviews
    Application
    Western blot
    Sample
    Cow Cell lysate - whole cell (vascular endothelial cells)
    Loading amount
    20 µg
    Specification
    vascular endothelial cells
    Gel Running Conditions
    Reduced Denaturing (15%)
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Mar 22 2011

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.