Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
Key features and details
- Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a
- Suitable for: ICC/IF, IHC-P, WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-CDKN2A/p16INK4a antibody [DCS50.1]
See all CDKN2A/p16INK4a primary antibodies -
Description
Mouse monoclonal [DCS50.1] to CDKN2A/p16INK4a -
Host species
Mouse -
Specificity
This antibody shows no cross reactivity with the closely related inhibitors p15INK4b and p18INK4c. -
Tested applications
Suitable for: ICC/IF, IHC-P, WB, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human CDKN2A/p16INK4a aa 1-156.
Sequence:MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG PSDIPD
Database link: P42771 -
Positive control
- WB: HEK-293 and HeLa cell lysates; Flow cyt: HEK-293 cells; IHC-P: Bladder tumor tissue, HPV-infected preneoplastic lesion in human uterine cervix; ICC/IF: Hepp cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.08% Sodium azide
Constituent: 99.9% PBS -
Concentration information loading...
-
Purity
Protein A/G purified -
Clonality
Monoclonal -
Clone number
DCS50.1 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab16123 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 1 µg/ml.
|
|
IHC-P |
Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
|
|
WB | (1) |
Use at an assay dependent concentration. Detects a band of approximately 16 kDa (predicted molecular weight: 16 kDa).
|
Flow Cyt |
Use 1µg for 106 cells.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
ICC/IF
Use a concentration of 1 µg/ml. |
IHC-P
Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol. |
WB
Use at an assay dependent concentration. Detects a band of approximately 16 kDa (predicted molecular weight: 16 kDa). |
Flow Cyt
Use 1µg for 106 cells. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Cellular localization
Cytoplasmic and Nuclear -
Database links
- Entrez Gene: 1029 Human
- Omim: 600160 Human
- SwissProt: P42771 Human
-
Form
There are 4 isoforms produced by alternative splicing. Isoform 1 also known as: p16INK4a; Isoform 3 also known as: p12; Isoform 4 also known as: p14ARF; p19ARF; ARF. -
Alternative names
- CCM2 antibody
- CDK4 inhibitor p16 INK4 antibody
- CDK4I antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded, HPV-infected, preneoplastic lesion in human uterine cervix tissue labelling CDKN2A/p16INK4a with ab16123. Antigen retreival was performed with Tris/EDTA buffer pH 9.
-
All lanes : Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123) at 1 µg/ml
Lane 1 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate
Lane 2 : HEK293 (Human embryonic kidney cell line) Whole Cell Lysate
Lysates/proteins at 10 µg per lane.
Secondary
All lanes : Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 16 kDa
Observed band size: 16 kDa
Additional bands at: 37 kDa, 50 kDa. We are unsure as to the identity of these extra bands.
Exposure time: 12 minutes -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDKN2A/p16INK4a antibody [DCS50.1] (ab16123)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded bladder tumor tissue labelling CDKN2A/p16INK4a with ab16123 at 10µg/ml.
-
ICC/IF image of ab16123 stained Hepp cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
-
Overlay histogram showing HEK293 cells stained with ab16123 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab16123, 1µg/1x106 cells ) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 100% methanol used under the same conditions.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (6)
ab16123 has been referenced in 6 publications.
- Göbl C et al. Cysteine oxidation triggers amyloid fibril formation of the tumor suppressor p16INK4A. Redox Biol 28:101316 (2020). PubMed: 31539802
- Yang C et al. Study of the cytological features of bone marrow mesenchymal stem cells from patients with neuromyelitis optica. Int J Mol Med 43:1395-1405 (2019). PubMed: 30628649
- Kannappan R et al. p53 Modulates the Fate of Cardiac Progenitor Cells Ex Vivo and in the Diabetic Heart In Vivo. EBioMedicine 16:224-237 (2017). PubMed: 28163043
- Fernández-Torrón R et al. Cancer risk in DM1 is sex-related and linked to miRNA-200/141 downregulation. Neurology 87:1250-7 (2016). PubMed: 27558368
- Capell BC et al. MLL1 is essential for the senescence-associated secretory phenotype. Genes Dev 30:321-36 (2016). PubMed: 26833731
- Dou Z et al. Autophagy mediates degradation of nuclear lamina. Nature 527:105-9 (2015). WB ; Human . PubMed: 26524528