Overview

  • Product name
  • Description
    Rabbit polyclonal to CDKN3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 67-116 (

    LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

    ) of Mouse CDKN3 (NP_082498).

  • Positive control
    • Mouse heart lysate IF/ICC: NIH 3T3 cell line.

Properties

Applications

Our Abpromise guarantee covers the use of ab118702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.
  • Involvement in disease
    Defects in CDKN3 are found in patients with hepatocellular carcinoma (HCC) [MIM:114550].
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family.
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links
  • Alternative names
    • CDI1 antibody
    • Cdk associated protein phosphatase antibody
    • CDK2 associated dual specificity phosphatase antibody
    • CDK2-associated dual-specificity phosphatase antibody
    • CDKN3 antibody
    • CDKN3_HUMAN antibody
    • CIP2 antibody
    • Cyclin dependent kinase inhibitor 3 antibody
    • Cyclin dependent kinase interacting protein 2 antibody
    • Cyclin dependent kinase interactor 1 antibody
    • Cyclin-dependent kinase inhibitor 3 antibody
    • Cyclin-dependent kinase interactor 1 antibody
    • Cyclin-dependent kinase-interacting protein 2 antibody
    • FLJ25787 antibody
    • KAP antibody
    • KAP1 antibody
    • Kinase associated phosphatase antibody
    • Kinase-associated phosphatase antibody
    • MGC70625 antibody
    • OTTHUMP00000178991 antibody
    see all

Images

  • ab118702 stained NIH 3T3 cells. The cells were 4% formaldehyde fixed for 10 minutes at room temperature and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1hour at room temperature to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab118702 at 5µg/ml) overnight at +4°C. The secondary antibody (pseudo-colored green) was Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) preadsorbed (ab150081) used at a 1/1000 dilution for 1hour at room temperature. Alexa Fluor® 594 WGA was used to label plasma membranes (pseudo-colored red) at a 1/200 dilution for 1hour at room temperature. DAPI was used to stain the cell nuclei (pseudo-colored blue) at a concentration of 1.43µM for 1hour at room temperature.

     

  • Anti-CDKN3 antibody (ab118702) at 1 µg/ml + Mouse heart lysate at 10 µg

    Predicted band size: 24 kDa



    Gel concentration: 12%

References

This product has been referenced in:
  • Deng M  et al. Silencing cyclin-dependent kinase inhibitor 3 inhibits the migration of breast cancer cell lines. Mol Med Rep 14:1523-30 (2016). WB ; Human . Read more (PubMed: 27314680) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

Thank you for contacting us. I am sorry that the other CDNK3 products have not been acceptable in your assays and that you have been experiencing issues when using ab119242. This product would be able to detect endogenous CDKN3, the cell line chosen for the blot should not express this protein. We attempt to share all data that we may have for a particular product on our datasheet. If you would like to share the details of your protocol with me I may be able to offer suggestions that may improve your results. The antibody is covered under our Abpromise for six months and is guaranteed to work in WB on human samples. If you are experiencing issues with this product and we cannot resolve the issue you are having, then I would be happy to either send a replacement antibody or to process a refund. Although I am unable to share information about the origin of ab64974, may I recommend searching for similar product using Biocompare.com. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up