Overview

  • Product name
  • Description
    Rabbit polyclonal to CDKN3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant full length protein corresponding to Human CDKN3.
    Sequence:

    MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPG CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG IITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLV AACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL SSRDSQSRSVSR


    Database link: Q16667

  • Positive control
    • Mouse heart extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab175393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.

Target

  • Function
    May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.
  • Involvement in disease
    Defects in CDKN3 are found in patients with hepatocellular carcinoma (HCC) [MIM:114550].
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family.
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links
  • Alternative names
    • CDI1 antibody
    • Cdk associated protein phosphatase antibody
    • CDK2 associated dual specificity phosphatase antibody
    • CDK2-associated dual-specificity phosphatase antibody
    • CDKN3 antibody
    • CDKN3_HUMAN antibody
    • CIP2 antibody
    • Cyclin dependent kinase inhibitor 3 antibody
    • Cyclin dependent kinase interacting protein 2 antibody
    • Cyclin dependent kinase interactor 1 antibody
    • Cyclin-dependent kinase inhibitor 3 antibody
    • Cyclin-dependent kinase interactor 1 antibody
    • Cyclin-dependent kinase-interacting protein 2 antibody
    • FLJ25787 antibody
    • KAP antibody
    • KAP1 antibody
    • Kinase associated phosphatase antibody
    • Kinase-associated phosphatase antibody
    • MGC70625 antibody
    • OTTHUMP00000178991 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175393. Blue DAPI for nuclear staining.
  • Anti-CDKN3 antibody (ab175393) at 1/500 dilution + Mouse heart extract

    Predicted band size: 24 kDa

References

ab175393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up