Anti-CDR2L antibody (ab121705)
Key features and details
- Rabbit polyclonal to CDR2L
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-CDR2L antibody -
Description
Rabbit polyclonal to CDR2L -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human CDR2L aa 395-464.
Sequence:DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIF SRIQKTKADINATKVKTHSS
-
Positive control
- IHC-P: Human duodenum, cerebellum and pancreas tissue; WB: RT-4, U-251 MG and Tonsil tissue lysate; ICC/IF: U-2OS cells.
-
General notes
This product was previously labelled as CDRL2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab121705 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Belongs to the CDR2 family. - Information by UniProt
-
Database links
- Entrez Gene: 30850 Human
- Entrez Gene: 237988 Mouse
- Entrez Gene: 360656 Rat
- SwissProt: Q86X02 Human
- SwissProt: A2A6T1 Mouse
- Unigene: 78358 Human
- Unigene: 102872 Mouse
- Unigene: 145144 Rat
-
Alternative names
- cdr2l antibody
- CDR2L_HUMAN antibody
- Cerebellar degeneration-related protein 2-like antibody
see all
Images
-
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)
Immunohistochemical analysis of paraffin-embedded human duodenum tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunofluorescent staining of Human cell line U-2 OS shows positivity in cytoplasm. Recommended concentration of ab121705 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
All lanes : Anti-CDR2L antibody (ab121705) at 1/250 dilution
Lane 1 : RT-4 cell lysate.
Lane 2 : U-251 MG cell lysate.
Lane 3 : Human Plasma
Lane 4 : Human Liver tissue lysate.
Lane 5 : Human Tonsil tissue lysate.
Developed using the ECL technique. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)
Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)
Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue labelling CDR2L with ab121705 at 1/50 dilution.
Protocols
Datasheets and documents
References (0)
ab121705 has not yet been referenced specifically in any publications.