Anti-CDR2L antibody (ab121705)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CDR2L antibody -
Description
Rabbit polyclonal to CDR2L -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human CDR2L aa 395-464.
Sequence:DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIF SRIQKTKADINATKVKTHSS
-
Positive control
- IHC-P: Human duodenum, cerebellum and pancreas tissue; WB: RT-4, U-251 MG and Tonsil tissue lysate; ICC/IF: U-2OS cells.
-
General notes
This product was previously labelled as CDRL2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab121705 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
|
| WB | 1/250 - 1/500. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Belongs to the CDR2 family. - Information by UniProt
-
Database links
- Entrez Gene: 30850 Human
- Entrez Gene: 237988 Mouse
- Entrez Gene: 360656 Rat
- SwissProt: Q86X02 Human
- SwissProt: A2A6T1 Mouse
- Unigene: 78358 Human
- Unigene: 102872 Mouse
- Unigene: 145144 Rat
-
Alternative names
- cdr2l antibody
- CDR2L_HUMAN antibody
- Cerebellar degeneration-related protein 2-like antibody
see all
Images
-
Western blot - Anti-CDR2L antibody (ab121705)Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human duodenum tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunocytochemistry/ Immunofluorescence - Anti-CDR2L antibody (ab121705)Immunofluorescent staining of Human cell line U-2 OS shows positivity in cytoplasm. Recommended concentration of ab121705 1-4 µg/ml. Cells treated with PFA/Triton X-100. -
Western blot - Anti-CDR2L antibody (ab121705)All lanes : Anti-CDR2L antibody (ab121705) at 1/250 dilution
Lane 1 : RT-4 cell lysate.
Lane 2 : U-251 MG cell lysate.
Lane 3 : Human Plasma
Lane 4 : Human Liver tissue lysate.
Lane 5 : Human Tonsil tissue lysate.
Developed using the ECL technique. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human pancreas tissue labelling CDR2L with ab121705 at 1/50 dilution.
Protocols
Datasheets and documents
References
ab121705 has not yet been referenced specifically in any publications.
