Anti-CDX2 antibody [3G9B9] (ab181488)
Key features and details
- Mouse monoclonal [3G9B9] to CDX2
- Suitable for: WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-CDX2 antibody [3G9B9]
See all CDX2 primary antibodies -
Description
Mouse monoclonal [3G9B9] to CDX2 -
Host species
Mouse -
Tested Applications & Species
Application Species Flow Cyt HumanWB HumanRecombinant fragment -
Immunogen
Recombinant fragment corresponding to Human CDX2 aa 176-303. (Expressed in E.coli).
Sequence:SLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGL SERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPL RSVPEPLSPVSSLQASVPGS VPGVLGPT
Database link: Q99626 -
Positive control
- Human CDX2 (AA: 176-303) recombinant protein; CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate; HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
3G9B9 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181488 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
Flow Cyt |
Human
|
WB |
Human
Recombinant fragment
|
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 33 kDa.
|
|
Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 33 kDa. |
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
Target
-
Function
Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. -
Sequence similarities
Belongs to the Caudal homeobox family.
Contains 1 homeobox DNA-binding domain. -
Post-translational
modificationsPhosphorylation of Ser-60 mediates the transactivation capacity. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1045 Human
- Omim: 600297 Human
- SwissProt: Q99626 Human
- Unigene: 174249 Human
-
Alternative names
- Caudal type homeo box 2 antibody
- Caudal type homeo box transcription factor 2 antibody
- Caudal type homeobox 2 antibody
see all
Images
-
Flow cytometric analysis of Hela cells labeling CDX2 with ab181488 at 1/200 dilution (green) compared to a negative control (red).
-
All lanes : Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 33 kDa -
Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution + CDX2 (AA: 176-303) recombinant protein.
Predicted band size: 33 kDaExpected MWt is 40.1 kDa.
Datasheets and documents
References (0)
ab181488 has not yet been referenced specifically in any publications.