For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    cdx2-antibody-3g9b9-ab181488.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Stem Cells Lineage Markers Endoderm
Share by email

Anti-CDX2 antibody [3G9B9] (ab181488)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)
  • Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
  • Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)

Key features and details

  • Mouse monoclonal [3G9B9] to CDX2
  • Suitable for: WB, Flow Cyt
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Protein
Product image
Recombinant Human CDX2 protein (ab114247)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-CDX2 antibody [3G9B9]
    See all CDX2 primary antibodies
  • Description

    Mouse monoclonal [3G9B9] to CDX2
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    WB
    Human
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human CDX2 aa 176-303. (Expressed in E.coli).
    Sequence:

    SLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGL SERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPL RSVPEPLSPVSSLQASVPGS VPGVLGPT


    Database link: Q99626
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human CDX2 (AA: 176-303) recombinant protein; CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate; HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    3G9B9
  • Isotype

    IgG1
  • Research areas

    • Stem Cells
    • Lineage Markers
    • Endoderm
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Developmental Biology
    • Lineage specification
    • Endoderm
    • Developmental Biology
    • Lineage specification
    • Trophectoderm

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Recombinant Protein

    • Recombinant Human CDX2 protein (ab114247)
  • Related Products

    • Recombinant Human CDX2 protein (ab114247)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab181488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Guaranteed

Tested applications are guaranteed to work and covered by our Abpromise guarantee.

Predicted

Predicted to work for this combination of applications and species but not guaranteed.

Incompatible

Does not work for this combination of applications and species.

Application Species
Flow Cyt
Human
WB
Human
Recombinant fragment
Application Abreviews Notes
WB
1/500 - 1/2000. Predicted molecular weight: 33 kDa.
Flow Cyt
1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Notes
WB
1/500 - 1/2000. Predicted molecular weight: 33 kDa.
Flow Cyt
1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine.
  • Sequence similarities

    Belongs to the Caudal homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-60 mediates the transactivation capacity.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession Q99626 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 1045 Human
    • Omim: 600297 Human
    • SwissProt: Q99626 Human
    • Unigene: 174249 Human
    • Alternative names

      • Caudal type homeo box 2 antibody
      • Caudal type homeo box transcription factor 2 antibody
      • Caudal type homeobox 2 antibody
      • Caudal type homeobox protein 2 antibody
      • Caudal type homeobox transcription factor 2 antibody
      • Caudal-type homeobox protein 2 antibody
      • CDX 2 antibody
      • CDX 3 antibody
      • CDX-3 antibody
      • Cdx2 antibody
      • CDX2/AS antibody
      • CDX2_HUMAN antibody
      • CDX3 antibody
      • Homeobox protein CDX 2 antibody
      • Homeobox protein CDX-2 antibody
      see all

    Images

    • Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)
      Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)

      Flow cytometric analysis of Hela cells labeling CDX2 with ab181488 at 1/200 dilution (green) compared to a negative control (red).

    • Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
      Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
      All lanes : Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution

      Lane 1 : HEK293 cell lysate
      Lane 2 : CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate

      Predicted band size: 33 kDa

    • Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
      Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
      Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution + CDX2 (AA: 176-303) recombinant protein.

      Predicted band size: 33 kDa



      Expected MWt is 40.1 kDa.

    Protocols

    • Western blot protocols
    • Flow cytometry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab181488? Please let us know so that we can cite the reference in this datasheet.

    ab181488 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab181488.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.