Anti-CDX2 antibody [3G9B9] (ab181488)
![Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)](https://www.abcam.com/ps/products/181/ab181488/Images/ab181488-210882-anti-cdx2-antibody-3g9b9-flow-cytometry.jpg "Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)")
Key features and details
- Mouse monoclonal [3G9B9] to CDX2
- Suitable for: WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-CDX2 antibody [3G9B9]
See all CDX2 primary antibodies -
Description
Mouse monoclonal [3G9B9] to CDX2 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human CDX2 aa 176-303. (Expressed in E.coli).
Sequence:SLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGL SERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPL RSVPEPLSPVSSLQASVPGS VPGVLGPT
Database link: Q99626 -
Positive control
- Human CDX2 (AA: 176-303) recombinant protein; CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate; HeLa cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
3G9B9 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181488 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB |
1/500 - 1/2000. Predicted molecular weight: 33 kDa.
|
|
| Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
| Notes |
|---|
|
WB
1/500 - 1/2000. Predicted molecular weight: 33 kDa. |
|
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
Target
-
Function
Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. -
Sequence similarities
Belongs to the Caudal homeobox family.
Contains 1 homeobox DNA-binding domain. -
Post-translational
modificationsPhosphorylation of Ser-60 mediates the transactivation capacity. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1045 Human
- Omim: 600297 Human
- SwissProt: Q99626 Human
- Unigene: 174249 Human
-
Alternative names
- Caudal type homeo box 2 antibody
- Caudal type homeo box transcription factor 2 antibody
- Caudal type homeobox 2 antibody
see all
Images
-
Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)
Flow cytometric analysis of Hela cells labeling CDX2 with ab181488 at 1/200 dilution (green) compared to a negative control (red).
-
![Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)](https://www.abcam.com/ps/products/181/ab181488/Images/ab181488-210880-anti-cdx2-antibody-3g9b9-western-blot.jpg)
Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)All lanes : Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 33 kDa -
![Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)](https://www.abcam.com/ps/products/181/ab181488/Images/ab181488-210879-anti-cdx2-antibody-3g9b9-western-blot.jpg)
Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution + CDX2 (AA: 176-303) recombinant protein.
Predicted band size: 33 kDaExpected MWt is 40.1 kDa.
Datasheets and documents
-
Datasheet download
References (0)
ab181488 has not yet been referenced specifically in any publications.
