Overview

  • Product name

    Anti-CDX2 antibody - N-terminal
    See all CDX2 primary antibodies
  • Description

    Rabbit polyclonal to CDX2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Hamster
  • Immunogen

    Recombinant fragment corresponding to Human CDX2 aa 1-46 (N terminal).
    Sequence:

    MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA


    Database link: Q99626

  • Positive control

    • ICC/IF: CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine.
  • Sequence similarities

    Belongs to the Caudal homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-60 mediates the transactivation capacity.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Caudal type homeo box 2 antibody
    • Caudal type homeo box transcription factor 2 antibody
    • Caudal type homeobox 2 antibody
    • Caudal type homeobox protein 2 antibody
    • Caudal type homeobox transcription factor 2 antibody
    • Caudal-type homeobox protein 2 antibody
    • CDX 2 antibody
    • CDX 3 antibody
    • CDX-3 antibody
    • Cdx2 antibody
    • CDX2/AS antibody
    • CDX2_HUMAN antibody
    • CDX3 antibody
    • Homeobox protein CDX 2 antibody
    • Homeobox protein CDX-2 antibody
    see all

Images

  • Immunofluorescent analysis of CACO-2 cells (PFA-fixed/Triton X-100 permeabilized) labeling CDX2 with ab220070 at 4 μg/mL (green).

References

ab220070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up