Overview

  • Product name

    Anti-CDX2 antibody [PCRP-CDX2-1A3]
    See all CDX2 primary antibodies
  • Description

    Mouse monoclonal [PCRP-CDX2-1A3] to CDX2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, Protein Arraymore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Hamster
  • Immunogen

    Recombinant full length protein corresponding to Human CDX2 aa 1-313.
    Sequence:

    MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAA AAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS PAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAAT AAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQ QQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVL GPTGGVLNPTVTQ


    Database link: Q99626

  • Positive control

    • IHC-P: Human colon carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Primary incubation for 30 minutes at room temperature.

Protein Array Use at an assay dependent concentration.

Target

  • Function

    Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine.
  • Sequence similarities

    Belongs to the Caudal homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-60 mediates the transactivation capacity.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Caudal type homeo box 2 antibody
    • Caudal type homeo box transcription factor 2 antibody
    • Caudal type homeobox 2 antibody
    • Caudal type homeobox protein 2 antibody
    • Caudal type homeobox transcription factor 2 antibody
    • Caudal-type homeobox protein 2 antibody
    • CDX 2 antibody
    • CDX 3 antibody
    • CDX-3 antibody
    • Cdx2 antibody
    • CDX2/AS antibody
    • CDX2_HUMAN antibody
    • CDX3 antibody
    • Homeobox protein CDX 2 antibody
    • Homeobox protein CDX-2 antibody
    see all

Images

  • ab236536 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Formalin-fixed, paraffin-embedded human colon carcinoma tissue stained for CDX2 using ab236536 at 1 μg/ml in immunohistochemical analysis.

References

ab236536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up